KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0912Help
Entry
LM5923_0912       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldo_ket_red S-AdoMet_synt_C
Motif
Other DBs
NCBI-ProteinID: ADB70756
Position
919847..920800
Genome map
AA seq 317 aa AA seqDB search
MEKIIVNGRKNGQKIEIACSNLVMGAGDFLRADNMDFAGPVLDQYFEMGGNIFDTARHYR
HSEKAIGAWMNMRGNRDSVIIQTKGGHPVREASDVPRVTPEAIHEDISVSLDTLQTDHVE
LFALHRDNPDVEVGSIMEAMHKEVEAGRVYAIGLSNWELSRIIEANEYAVNHGLTPLSFN
SPNFSLAKVNRPRWENCVSANEEMIRWHEATNLPLFSWSSQAGGFFSGRFSEEDTSDTEM
VEVYYSEANWERYSRAKQLANQKGCTPIQISLAYVLTQSFPTAAVIGPENTTELQSSVAA
AGIKLTASEVDWLDLKA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagattatcgttaacggtagaaaaaatggacaaaaaatcgagatagcttgttct
aatttagtgatgggtgcaggagatttcttacgtgcagataatatggattttgcgggtcca
gtactagatcaatatttcgaaatgggtggaaatatttttgatacggcgcgccattatcgc
catagtgaaaaagcgattggcgcttggatgaatatgcgaggaaatcgggatagtgtcatt
atccaaacgaaaggtggacatccagtccgggaagcaagcgacgtgccgcgtgttactccg
gaagcaattcacgaagatatttcggttagtttagatacgttacaaacagatcatgttgaa
ttattcgcacttcatcgcgacaatccagacgtagaagtgggttctattatggaggcgatg
cataaagaagtggaagctggacgcgtttacgctattgggctctcaaactgggagctctcg
cgcattatcgaagcgaatgaatatgcagtgaaccatggattgacaccactaagctttaac
agccctaattttagtttagcaaaagtgaatcgaccacgctgggaaaattgtgtttcggcg
aatgaagagatgattcgctggcatgaggcgacgaatttgccactattttcttggtcatca
caagcaggcggatttttctctggtagattttctgaggaagacacgagcgatacggaaatg
gtcgaagtttattatagtgaggcaaactgggaaagatacagtcgtgccaagcaactagct
aaccaaaaaggttgcacaccaattcaaatttcgcttgcctatgtattaacgcaatcattc
ccgacagccgctgtcatcggtccagaaaatactactgaacttcaatcttccgttgcagca
gcagggattaaattaacagcgtctgaggttgattggctggatttaaaggcataa

DBGET integrated database retrieval system