KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0914Help
Entry
LM5923_0914       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Collagen_bind LysM Gram_pos_anchor
Motif
Other DBs
NCBI-ProteinID: ADB70758
Position
921703..923091
Genome map
AA seq 462 aa AA seqDB search
MKKRWLVFAIICLIITGFLSPKAEAATDYGSSFFTNVSLQNQNGEQATNFKENSKVRVAY
DFVITQPVASGETMTLTIPDQLKLINYGGFPLMDSQGNTIANATIDQVTGTITLTFTDYV
NTHTDLIGSLFYNATFNSKNIQTDQVNPIAFPVKNTTQTVTPYISKVNSGGGTGSPTIVF
KQGRMDDKDLSILHWTVTLNNALTPIDNAVYTDTLGSGQNLLGSATIKYRDANKKVIATN
IQPIALDADRNFELSIGALNNQSVVITYDTKITTKQKSYTNKATLSGDNLDAVSRNATVN
DYGSGGQGTGTPPAPPVKEEPPFIPAEKQPIEKTVETDFGPLEIVKDSEQNGKIKVIYKV
KDGDTLPGVANKFDVSVAEIKDWNNLTSDTLQAGQKLQLTIEKTLLSKITVPPVQKVTST
TRVDGVVKATGVLPHTGDSNPFIPFVTGLSLIALGFTFGRKS
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagatggctggtttttgcaattatatgtttaattatcactggatttttaagt
ccaaaagcagaagctgcaacagattacgggagcagtttttttactaatgtatcattacaa
aatcaaaacggggaacaagcaacgaattttaaagaaaatagtaaagtgcgagtggcgtat
gattttgttattacacagccagttgcaagcggggaaacaatgacgcttactattcctgat
cagctaaaattaattaattatggcggatttcctctcatggattcgcaaggaaacactatc
gcaaatgcaactattgatcaagtaacgggaacgattacattaacttttaccgactacgta
aatacacatacagatttaattggtagccttttttataacgcaacttttaacagcaaaaat
attcaaacagatcaagtaaatccaatcgcatttccggtaaaaaatactactcaaacagta
actccatatattagtaaggtgaattcgggcggtggcacaggctcaccaacaattgttttt
aaacaaggtcgaatggatgataaagacttaagcattttacattggaccgttactttaaat
aatgcgctgacacctattgataatgctgtctatacggatacgctaggttcagggcaaaat
ctgcttggaagcgcaacaatcaaataccgagatgccaataaaaaagtgatagcgactaat
attcaacctattgcgctggatgcggatcgcaattttgaattatctattggcgcgttaaat
aatcaatctgtcgtcattacttatgatacgaaaattacgacaaaacaaaaaagctataca
aataaagcgacactatccggtgataacctagatgctgtttcgagaaatgcgacagtcaat
gattacggtagcggtggacaaggaacaggaacaccgccagcccccccggttaaagaagaa
ccaccatttattccggctgaaaagcaaccgattgaaaaaacagtcgaaacagattttggt
ccacttgaaatcgttaaagattccgaacaaaatggcaaaattaaagtcatttataaagtg
aaagatggcgatacattacctggagtagctaataagtttgatgtctccgttgcagaaatt
aaagactggaacaatctcacatcggatactttacaagccggtcaaaaattacaattaact
attgaaaaaacgctcttatcaaaaattaccgtgccacctgtgcaaaaagtgactagcaca
acaagggtagacggtgtcgtaaaagcaacaggggttttacctcatactggggattcgaac
ccatttatcccatttgtaacaggcctaagcttaatagcgcttggttttacatttggacgc
aaaagttaa

DBGET integrated database retrieval system