KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0918Help
Entry
LM5923_0918       CDS       T01164                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Pathway
lmy00860  Porphyrin and chlorophyll metabolism
lmy01100  Metabolic pathways
lmy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LM5923_0918
Enzymes [BR:lmy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     LM5923_0918
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     LM5923_0918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO NAD_binding_9 Pyr_redox_3 Pyr_redox_2 FAD_binding_2 HI0933_like Thi4 Pyr_redox GIDA FAD_oxidored Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: ADB70762
Position
925844..927223
Genome map
AA seq 459 aa AA seqDB search
MKHIVIIGGGLSGLAAAYELQKTHPNYTWELVEKDEKLGGKFETVKRDGFLIEKGPDSFL
ARKPAGVGLVKDLGLEDKLIANATGRSYIYHQKALHPIPEGSVMGIPTDKEALLASTLVS
EIGKARALQEPTMERNNQERDQALGDFFEARFGKELVKTIIEPLLSGIYAGDIYKMSLRA
TFPQFEQTVKKYGNLMDGLKESSMQTTGTKATIGAFRTLEGGLDALPKAIAAALPKENLH
TAKQATEIVKKNNAYEISFADGDKMEADGVIIAATHDALIHLLAETTTEPFAGQPLTTLA
TVSLAYNEQDVPILPDGTGYLVARTAPYKTTACTWVQKKWPHMVPKNKMLLRGFVGKAGE
TWLEQASDEAIVSAVLRDYAEIMDLHAAPLFYEVSRMKSAMPQYLVNHQDRLKQLKKNIK
TDYPGVFFAGMSYEGVGIPDCIAGAQTAAKELVDYLEEV
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacatatagtcattatcggaggcggcttatcagggctcgcagcagcgtatgaacta
caaaaaacacatccgaattatacgtgggaattagtagaaaaagacgaaaaactaggcggg
aaatttgaaacggttaaacgtgacgggtttttaattgaaaaaggtccagattccttctta
gctagaaaacctgctggtgtgggcttagtaaaagatttaggactcgaagataaactgatt
gcgaacgcgacaggaagatcttacatttaccaccaaaaagcgcttcatccgattccagaa
ggctctgtgatgggaattccgacagataaagaagcactgctagctagtacacttgtatcc
gaaattgggaaagctcgcgcacttcaagaaccaacaatggaacgaaataatcaagaacga
gatcaagcacttggcgatttctttgaagcgcgattcggtaaagaattagtcaaaacaatt
atcgaaccacttttatcaggaatttatgccggggatatatacaaaatgagtttacgcgcc
acttttccacaattcgaacaaacagttaaaaaatatgggaatttgatggatggtttaaaa
gaaagtagcatgcaaacgacagggacaaaagccactattggtgcttttagaacattagaa
ggtgggctagatgctttgccaaaagctattgccgccgcacttccaaaagaaaatttgcat
acagcaaaacaagcaacagaaattgtgaagaaaaataacgcttacgaaatttcttttgca
gatggcgataaaatggaggcagatggcgtcattatcgctgccacacatgatgcgttaatt
catttattagcagaaacaacgacagaaccattcgcgggacaaccgcttacgacccttgcg
accgtttcgttagcatataatgaacaagacgtaccgattttacctgatggaacaggctat
ctagttgccagaaccgcaccatataaaaccactgcttgtacatgggtgcagaaaaaatgg
ccgcatatggtaccaaagaacaaaatgttactacgaggctttgttgggaaagcaggagaa
acttggttagagcaagcaagcgatgaagcaatcgtctcagctgttttgagagattatgcg
gaaattatggaccttcacgccgcgccacttttttatgaagtaagccgaatgaaatccgcg
atgcctcaatacttagttaatcaccaggaccgactaaaacaattgaaaaagaacatcaaa
acagattacccaggtgttttttttgcaggaatgagctacgaaggtgtgggtattcctgat
tgcatcgcaggggctcaaacagccgctaaggaattagtagattacttggaagaggtgtaa

DBGET integrated database retrieval system