KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0921Help
Entry
LM5923_0921       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
  KO
K07723  CopG family transcriptional regulator / antitoxin EndoAI
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lmy03000]
    LM5923_0921
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:lmy02048]
    LM5923_0921
Transcription factors [BR:lmy03000]
 Prokaryotic Type
  Ribbon-helix-helix
   CopG family
    LM5923_0921
Prokaryotic defense system [BR:lmy02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   MazF-MazE
    LM5923_0921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RHH_1
Motif
Other DBs
NCBI-ProteinID: ADB70765
Position
928912..929190
Genome map
AA seq 92 aa AA seqDB search
MLEKENRMIISVELTQEMIQELDVVVEKEKMGRSEVIMEATQQFLQEKRARELRDEMERG
YAEMATINFAIACECTHVEAEAEDRNISILGG
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
gtgttagagaaagaaaatcggatgataatatccgtagaactgacacaggaaatgatacaa
gaactcgacgtagttgtagaaaaagaaaaaatggggcggagtgaagttataatggaagca
acgcaacagtttttacaagagaaaagggctcgcgaattaagagacgagatggaacgcggc
tatgcagagatggcgacaattaattttgctatcgcatgcgagtgtacccatgtcgaagca
gaagcagaagacaggaatattagtattttaggaggttaa

DBGET integrated database retrieval system