KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0922Help
Entry
LM5923_0922       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
  KO
K07171  mRNA interferase MazF [EC:3.1.-.-]
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:lmy02048]
    LM5923_0922
Enzymes [BR:lmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     LM5923_0922
Prokaryotic defense system [BR:lmy02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   MazF-MazE
    LM5923_0922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PemK_toxin Ribosomal_S15
Motif
Other DBs
NCBI-ProteinID: ADB70766
Position
929197..929541
Genome map
AA seq 114 aa AA seqDB search
MVKRGDVYYADLSPVVGSEQGGIRPVLIIQNDIGNRFSPTVIVAAITAKIQKAKLPTHVE
ATRKDGFERDSVILLEQIRTIDKQRLTDKITHLDEDLMAKVNKALEVSLGVVEF
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagcgtggtgacgtatactacgcggacctttcccccgtggtcggaagcgagcaa
gggggaatacggcctgttctcatcattcaaaatgatattggtaatagattcagtccaact
gtgatcgtggcagcaataactgcaaaaattcaaaaagcaaaattgccaacgcacgtggaa
gctactcgtaaagatggctttgagagagattctgtcattcttttagaacagattagaacg
attgataaacagcgcctgacagataaaattacgcatttggacgaagatttaatggccaag
gtaaacaaggcacttgaagtcagtctaggagtagtagaattttaa

DBGET integrated database retrieval system