KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0925Help
Entry
LM5923_0925       CDS       T01164                                 

Gene name
rsbT
Definition
(GenBank) hypothetical protein
  KO
K17752  serine/threonine-protein kinase RsbT [EC:2.7.11.1]
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lmy01001]
    LM5923_0925 (rsbT)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:lmy03021]
    LM5923_0925 (rsbT)
Enzymes [BR:lmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     LM5923_0925 (rsbT)
Protein kinases [BR:lmy01001]
 Serine/threonine kinases: Other
  Bacterial family
   LM5923_0925 (rsbT)
Transcription machinery [BR:lmy03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     LM5923_0925 (rsbT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c_2 HATPase_c
Motif
Other DBs
NCBI-ProteinID: ADB70769
Position
930994..931404
Genome map
AA seq 136 aa AA seqDB search
MTFQSCVKIINEWDIVAARQLGRKISKEIGFGTVDQARITTAISELARNIFLYAGRGEIC
IEKVSESGKQGMIIVAKDKGPGIVDIRKVMQDGYTTSGGLGAGLPGVKRLMDSFDIESSI
EGDSKGTVITTTKWVR
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgacattccaatcctgtgtaaagataattaatgaatgggatattgtagctgcaaggcaa
ctaggtagaaaaatatccaaagaaattggctttggaaccgttgaccaagcaagaattaca
actgccatcagtgaattagctagaaatattttcctttatgctggacgaggagaaatctgt
atcgaaaaagtaagtgaatctggtaaacaaggtatgattattgttgccaaagacaaaggt
ccaggtattgtagacataagaaaagtaatgcaagatggttatacaacatcaggtggtctt
ggagcaggtcttccaggagtcaaacgtttaatggacagttttgatattgaatccagtatt
gaaggcgattctaaaggaacggtaattacaacaacgaaatgggttcggtaa

DBGET integrated database retrieval system