KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0929Help
Entry
LM5923_0929       CDS       T01164                                 

Gene name
sigB
Definition
(GenBank) RNA polymerase sigma factor SigB
  KO
K03090  RNA polymerase sigma-B factor
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:lmy03021]
    LM5923_0929 (sigB)
Transcription machinery [BR:lmy03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     LM5923_0929 (sigB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r4 Sigma70_r2 Sigma70_r3 Sigma70_r4_2 HTH_23 HTH_16 RE_TdeIII DUF1492 GerE IF2_N
Motif
Other DBs
NCBI-ProteinID: ADB70773
Position
933354..934133
Genome map
AA seq 259 aa AA seqDB search
MPKVSQPDKEAKEKVYIWIAAYQENGDQDAQYNLVVHYKNLVESIARKYSQGKSFHEDLV
QVGNIGLLGAIRRYDATFGKSFEAFAVPTIVGEIKRFLRDKTWSVHVPRRIKELGPKIKN
AVEELTRELQSSPQISDIADFIGVTEEEVLEAMEMGKSYQALSVDHSIEADSDGSTITLL
DVVGGTDDGFERVNQRMLLEKVLPVLDEREQKILQYTFIENRSQKETGELLDISQMHVSR
IQRQAIKKLREALQNEEVE
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaagtatctcaacctgataaagaggcgaaagaaaaagtctatatttggattgcc
gcttaccaagaaaatggcgatcaagacgcccaatataatttagttgttcattacaaaaac
ctagtagagtccatcgcccgaaaatattcccaaggtaaatcttttcatgaagatttagtt
caagttgggaatattggtttacttggagctattagaagatatgatgcaacgtttggaaaa
agctttgaagcatttgctgtgccaacaattgttggtgaaatcaaacggtttttacgtgat
aaaacatggagtgtccatgtgccgcgccgaatcaaagagttaggtccgaaaatcaaaaat
gccgtagaagagctaacgagagaacttcaaagctcgccgcaaattagcgacattgctgat
tttattggtgtcacggaagaagaagttttagaagcaatggaaatgggaaaaagctaccaa
gcactttctgtagatcattcgattgaagctgattcggatggaagtacgattacgttactt
gatgttgttggtggtacggatgatggatttgaacgtgtgaatcaacgtatgctcttagag
aaagttctccctgttttagatgagcgagaacagaagattttgcaatatacatttattgaa
aatcgcagtcaaaaagaaacgggtgaactactcgatatatcacaaatgcatgtgtctaga
atccaacgtcaagctattaaaaaacttcgagaggcgttgcagaatgaggaagtggagtaa

DBGET integrated database retrieval system