KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0930Help
Entry
LM5923_0930       CDS       T01164                                 

Gene name
rsbX
Definition
(GenBank) indirect negative regulation of sigma B dependant gene expression (serine phosphatase)
  KO
K05518  phosphoserine phosphatase RsbX [EC:3.1.3.3]
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:lmy03021]
    LM5923_0930 (rsbX)
Enzymes [BR:lmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.3  phosphoserine phosphatase
     LM5923_0930 (rsbX)
Transcription machinery [BR:lmy03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     LM5923_0930 (rsbX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoIIE PP2C_2 DIMCO_N
Motif
Other DBs
NCBI-ProteinID: ADB70774
Position
934134..934733
Genome map
AA seq 199 aa AA seqDB search
MNKAVESNNLFVFQRSKALQQYCGDVYYTHEDENGFLYVLSDGLGSGLEANRAAKATVDA
IKEDIHADITDMLEKANQAVSGLRGAAIAIIKGDYLTKTLYYTGMGNIRFYMIGIEDKLI
FPLSGSGFLSGRKQKYRLQSFKYKPGSKFLMHSDGLVLSRVRKSLESPLCVVKTGHLIER
NILDIPTDDVTFMVGKFPE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggcagttgaatcaaataatttatttgtatttcaacgttctaaagcattacaa
caatactgcggggatgtttattatacccatgaagacgaaaatggttttctgtatgttctt
tctgatggacttggaagtgggctcgaagctaatagagcggccaaagcgactgttgacgcc
ataaaagaagatattcatgcagatattactgatatgcttgaaaaagcgaaccaggctgtt
tcagggcttcgtggtgctgcgatagctattattaaaggtgactacttaacgaagacactt
tattatactggtatgggtaatattcgtttttatatgattgggattgaagataagcttatt
tttccgctttcaggctctggatttttgtccggtcgaaaacagaaatatcggttgcaatcg
tttaaatataaaccaggcagtaagtttttaatgcattcagatggacttgttctttctcgc
gttagaaaaagcctagaatcaccactttgtgtagtgaaaaccgggcatttaatcgagcgt
aatatattagatattccaacagatgatgtaacttttatggttgggaaatttccggaataa

DBGET integrated database retrieval system