KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0942Help
Entry
LM5923_0942       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 AAA_24
Motif
Other DBs
NCBI-ProteinID: ADB70786
Position
946210..946884
Genome map
AA seq 224 aa AA seqDB search
MGKKLSLYFVRHGQTYLNKNLRMQGWADTPLTPEGIEIVKESGRGLAETEFVAAYSSDLH
RTIATAGHLLKENKHAFGLTLEPLSEFRETFFGTYEGEKGDVAWNEIAHHMGYANQEELF
QNADVRETMNGTKAADPTGDAEDFMTFWTRVEQGFLHVINRHRETGGNVLIVAHGNTIRN
IVHELEPSMDEAVILDNASVTVLAYENGLFKLERLNDTSHFKKA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaaaattatcactttattttgtaagacatggtcaaacctacttaaacaaaaat
ttgcgcatgcaaggctgggctgatacgccactgacaccagaaggaattgaaatagtcaaa
gaaagtggtcgaggtcttgctgaaacagagttcgtcgcagcatattcaagtgacttacac
cgcacaatcgcgacagctggccacttgcttaaagaaaataaacacgcattcggcttaacg
cttgagccattaagtgaatttcgggaaactttcttcggcacctacgaaggtgaaaaaggc
gatgttgcctggaacgaaattgcacatcatatgggatatgcgaatcaagaagagctattc
caaaatgccgatgtgcgcgaaacaatgaacggtacaaaagcggctgatccaaccggagat
gcggaagatttcatgacattttggacgcgcgtagaacaaggtttcttacacgttatcaat
cgtcatagagaaactggcggaaacgtccttatcgtcgctcacggaaacactattcgtaac
atcgtccacgaactagaaccatccatggacgaagcggttatcctcgacaatgcaagtgtt
actgtactagcttacgaaaacggcttattcaaattagaacgtttaaatgacacctcccat
tttaaaaaagcatag

DBGET integrated database retrieval system