KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0944Help
Entry
LM5923_0944       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GntR HTH_41 RepL HTH_Crp_2 LRR_9
Motif
Other DBs
NCBI-ProteinID: ADB70788
Position
948204..948596
Genome map
AA seq 130 aa AA seqDB search
MLLAIDLQSDEPIYTQICNQIIEGMAKRELLPGDKLPSVRSLGADIGINFHTVNKAYQIL
KQEGFIQIHRQKGVVIHPDGVAKADELFFTKLQTKLKPLIAESVVRGVTEEKWLEVSKAI
FDEMHGRRVE
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgttacttgcaattgatcttcaatcagacgagccaatttatacacaaatatgcaatcaa
atcatcgaaggcatggcgaaacgggaacttttaccaggagacaaattaccttctgttcgg
agtcttggtgcagatatcggaattaattttcatactgtaaacaaggcctaccaaatttta
aaacaagaaggatttattcaaatacatcgtcaaaaaggagtggttattcatccggatggg
gtagctaaggcagatgagctattttttactaaattacaaacgaagctaaaaccactcatc
gcggaatcggttgtgcgcggtgtcaccgaagagaagtggctcgaagtaagtaaagcaatt
tttgacgaaatgcatggacggagagtggagtag

DBGET integrated database retrieval system