KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0947Help
Entry
LM5923_0947       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
  KO
K21993  formate transporter
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lmy02000]
    LM5923_0947
Transporters [BR:lmy02000]
 Other Transporters
  Pores ion channels [TC:1]
   LM5923_0947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Form_Nir_trans
Motif
Other DBs
NCBI-ProteinID: ADB70791
Position
950402..951214
Genome map
AA seq 270 aa AA seqDB search
MGYYSPQEVTEITIEKGTQKANSSTLTLVLLGFLGGAFISLGYLLYIRAVGTMPHEWGSF
ATLIGASLFPVGLVCILLGGGELITGNMMAVAIAWYDKKISFQQLLRNWAIVSVMNLVGA
FFVAYFFGHFVGLTEGDFLPKTLATAGAKINDPFWVAFVSGIGCNWFVGIAVWLCYAAKD
FAGKILGIWFPVMAFVAIGFQHVVANMFIIPAAIFAGYYSWADFIWNVIPVYLGNVVGGA
VFVSLFYFLAYKKNAPKKVKEEIHQPIEEN
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgggatattacagcccgcaggaagtaacagagattacgattgaaaaaggaacccaaaaa
gcaaattcaagtacattaacacttgtgttgttaggctttttaggtggagcttttatatct
cttggttacttattatacatacgtgcagtaggaacaatgcctcacgaatggggaagcttt
gcaacgctcattggcgccagtctttttccggttggcctcgtttgtattttgctaggtgga
ggagaattaattaccggcaacatgatggctgttgcaattgcttggtacgacaaaaagatt
tccttccaacaattacttagaaactgggcgattgtgtccgtcatgaacttagtgggcgca
ttttttgtcgcttacttcttcggacatttcgttggcttaacagaaggcgatttcttaccc
aaaacgttagctacagctggcgcaaaaattaacgatcctttctgggttgcctttgtttca
ggaattggttgtaactggtttgttgggattgctgtttggctttgttacgcggccaaagat
ttcgcagggaaaatccttggtatttggttcccggttatggcatttgttgctatcggattt
cagcacgttgttgccaatatgtttattattccagctgctatttttgctggttactattca
tgggcagattttatttggaacgtcatcccggtttacctagggaatgtagtcggcggagca
gtttttgttagcctattctacttccttgcttataagaaaaacgcgcctaaaaaggtaaaa
gaagaaatacaccaaccaattgaagaaaattaa

DBGET integrated database retrieval system