KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0948Help
Entry
LM5923_0948       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Pathway
lmy00250  Alanine, aspartate and glutamate metabolism
lmy00310  Lysine degradation
lmy00350  Tyrosine metabolism
lmy00650  Butanoate metabolism
lmy00760  Nicotinate and nicotinamide metabolism
lmy01100  Metabolic pathways
lmy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmy00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    LM5923_0948
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LM5923_0948
   00310 Lysine degradation
    LM5923_0948
   00350 Tyrosine metabolism
    LM5923_0948
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    LM5923_0948
Enzymes [BR:lmy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     LM5923_0948
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     LM5923_0948
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     LM5923_0948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF1442
Motif
Other DBs
NCBI-ProteinID: ADB70792
Position
951438..952904
Genome map
AA seq 488 aa AA seqDB search
MSIKETALPKVQTKLFINGKWTDGDNKETKDIVNPANGDVIAKIAQAGPSETKKAIKAAK
DAFPDWAKMELADRVKLLHKIADLMEEKADTLAKIMTLEQGKPLKESKGEVLTGVENFRF
AAEEARRLYGETIPAPNNHAFIVKKQPIGVVAAITPWNFPGGMVTRKLAPALATGNTIVL
KPSGDTPLSALAIFEIFEEAGLPKGVANIVMGSSKEIGETLTDSDDVRKLTFTGSTKVGQ
TLFKQSADTLKKISLELGGHAPFIVFDDANLDAAVNDLVAAKFRNNGQVCVSPNRIFVAK
EIKEKFTKALVAKVEQLKVGNGLDDVNVGPLIREDAIDKIDKQLKNATEKGAKVLTGGGR
LTGSDYDKGNFYKPTVLDNVTRKMDIFYEETFGPVIPLITFETEDEAIEMANDSEFGLAS
YFYTKDLARVEKVGAALEYGMVGANEIAISNPETPFGGVKHSGFGRENGHYGMEEYIQVK
FINLKYRD
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
ttgagtattaaagaaacagcattaccaaaagttcaaacaaaattatttattaatggaaaa
tggacggatggagataataaagaaacaaaagatattgtaaatccagcaaacggagatgtt
attgcaaaaatcgctcaagctggaccaagtgaaacaaaaaaagctattaaagcggcaaaa
gatgcatttcctgattgggcaaaaatggaactagctgaccgtgtcaaattattacacaaa
attgccgatttaatggaagaaaaagcagatacgttagcaaaaattatgacgcttgaacaa
ggtaaaccgctaaaagaatcaaaaggagaagtcttaactggcgtagaaaacttccgattc
gctgcggaagaagcaagaagattatatggtgaaacaatccctgctccaaacaatcatgcg
tttatcgtgaaaaaacaaccaattggcgtagttgctgctattactccttggaatttccca
ggtggtatggtgacgcggaaacttgcaccggcgctggcaactgggaatacaattgtatta
aaaccttctggagatacgccgctttcggctctagctatttttgaaatttttgaagaagct
ggcttgccaaaaggcgttgcaaatatcgttatgggtagctccaaagaaatcggtgaaacg
ttaactgatagtgatgatgttcgtaaactaactttcactggttccacgaaagttggtcaa
acactctttaaacaatcagccgatacactgaaaaaaatctcactcgaacttggtggtcat
gcgccatttatcgtatttgatgatgcgaatcttgatgccgctgtaaatgatttagttgct
gcaaaattccgcaacaacggtcaagtatgcgtgtcaccaaaccgaattttcgttgccaaa
gaaatcaaagaaaaattcactaaagcgttagttgctaaagtagaacaattaaaagttggt
aacggtttagatgacgtgaatgttggtccgcttatccgcgaagatgcgatagataaaatt
gataaacaacttaaaaacgccacagaaaaaggtgctaaagtcttaactggtggcggtcgt
ctaacaggctctgactatgataaaggaaacttttataaacccactgtcttagataatgtt
acccgtaaaatggacattttttatgaagaaacatttggtccagtaatcccgctcatcaca
tttgaaacggaagacgaagcaatcgaaatggcgaatgacagtgaattcggtcttgcttct
tacttctacactaaagacttagcacgcgtagaaaaagtgggagcagcactagaatacgga
atggtcggagcaaatgaaattgccatctctaacccagaaactccatttggtggagtaaaa
cattctggtttcggtcgcgaaaacggtcattatggaatggaagaatacatccaagtgaaa
ttcatcaacttaaaatatcgtgattaa

DBGET integrated database retrieval system