KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0961Help
Entry
LM5923_0961       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
  KO
K19005  lipoteichoic acid synthase [EC:2.7.8.20]
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Pathway
lmy00561  Glycerolipid metabolism
lmy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    LM5923_0961
Enzymes [BR:lmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.20  phosphatidylglycerol---membrane-oligosaccharide glycerophosphotransferase
     LM5923_0961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sulfatase DUF229 DUF4126 Phosphodiest
Motif
Other DBs
NCBI-ProteinID: ADB70805
Structure
PDB: 

Position
complement(965979..967940)
Genome map
AA seq 653 aa AA seqDB search
MKDWKIKIQTFLSKNYGFFVLAVILYWLKTYIAYQLEFKLGIENLMQQILLFINPLSGAI
FFMGLALFAKGRRSFIWIIVIDFLMSFILYANIVYYRFFSDFITLPNLNAKQMQNMGDMG
SSITALLSWHDIIYFADIIILIALLAFRFVKPNKTARIRARKVVGVLTLGIAMFFGNLGL
AEIDRPQLLTRTFDRNYIVKYLGMTNYQIYDAVKSTESSTQRALADSSDVTEVLNYTKSK
YAAPNPEYFGKAKGKNVIYIHLESFQQFLVNYKLNGEEVTPFINSFFKDQNTLSFTNFFH
QTGQGKTADSEMLLENSLYGLPQGSAFTTKGQNTYESASAILGQQGYTSAVFHGNYKSFW
NRDEIYKQFGYDNFFDASYYDMNEADVSNYGLKDKPFFKESEEYLSSLQQPFYTKFITLT
NHFPYPIDEKDASIAPATTGDSSVDTYFQTARYLDESVKSFVDYLKKSGLYDNSVIIMYG
DHYGISDNHEEAMTKILGKDYNTFENAQAQRVPLMIHVPGVQGGVQEQYGGQVDLLPTLL
HLLGVDNKEYLQFGTDLLSKDHKQLVPFRNGDYITPTYSMIGGNMYNQQTGEPIATETKE
MKETKEKVAKELELSDSVLQGDLLRFYAPDGFKKVDPSKYNYNKKKSTDSSDK
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgaaggattggaaaataaaaatccaaacgtttttaagcaagaattatggattttttgtt
ctagccgtcattctttattggctaaaaacgtatatcgcatatcaacttgaatttaaactt
ggcatagaaaatctgatgcagcaaattttgctgttcattaatccattaagtggggccatt
ttctttatgggtcttgcgctctttgccaagggacgtcgttcattcatttggattatcgtc
attgactttttaatgagttttattctttacgcaaatattgtatattatagattctttagt
gatttcattacgcttccgaatctaaacgcaaaacaaatgcaaaacatgggcgacatggga
agtagtatcacagcgttactcagctggcacgatattatttacttcgcggatattatcatt
ttaattgcactacttgctttccgctttgtaaaaccaaacaaaacagcccgtattcgtgcg
agaaaagtagttggggttctaacgcttggtatcgcaatgttctttggtaatttgggactt
gcagaaattgatcgtccacaacttttaacaagaacatttgatagaaattatattgttaaa
tatctaggtatgactaactaccaaatctacgacgcagtgaaaagtactgaatcatctacc
cagcgtgcacttgctgatagtagtgatgttactgaagttttaaactatactaaatccaaa
tatgccgcgccaaacccggaatatttcggtaaagcaaaaggcaaaaacgtcatttatatt
catttagagagtttccaacaattcctagtgaattacaaattaaatggagaagaagtaacg
ccgtttattaactctttctttaaagaccaaaatacactaagctttacaaacttcttccac
caaactggacaagggaaaacagctgactccgaaatgttacttgagaactcgctttacggc
ctgcctcaaggttctgcctttactactaaaggccaaaacacctatgaatctgcatctgct
attttaggccaacaaggctatacaagtgctgtattccatggtaactataagagcttctgg
aatcgtgatgaaatttataaacaattcggttacgacaatttctttgatgccagttactat
gatatgaacgaagcagatgtttctaactacggacttaaagataaaccattctttaaagag
tccgaagaatatctatcgtcattacaacaaccgttctacacgaaatttattacgcttacg
aaccatttcccttatccaattgatgagaaagatgcttcgattgctccggcaacaacaggc
gattcatctgtagatacgtatttccaaacagctcgttatttagacgaatctgtgaagagc
tttgttgattacttgaagaaatctggtctttacgataactctgtcattatcatgtacggt
gaccattatggtatttccgacaaccatgaagaagcaatgacaaaaattcttggtaaagat
tacaacacttttgaaaatgcccaagcgcaacgtgttcctttaatgattcacgttcccggt
gttcaaggtggcgttcaagaacaatacggtggccaagttgacctacttcctacattactt
cacttacttggtgttgataataaagagtacttgcaatttggtacagatttactttctaaa
gaccataaacaacttgttccattccgaaacggtgattatataactcctacctattcaatg
attggtggtaacatgtataatcaacaaactggggaaccgattgctacggaaacaaaagaa
atgaaagaaaccaaagaaaaagtagcaaaagaattagagctttcagattctgtactacaa
ggtgacttgttgcgtttctatgctcctgatggtttcaaaaaagtggatccaagtaaatac
aattacaataagaaaaaatcaactgattcatccgataaataa

DBGET integrated database retrieval system