KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0970Help
Entry
LM5923_0970       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
  KO
K03216  tRNA (cytidine/uridine-2'-O-)-methyltransferase [EC:2.1.1.207]
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lmy03016]
    LM5923_0970
Enzymes [BR:lmy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.207  tRNA (cytidine34-2'-O)-methyltransferase
     LM5923_0970
Transfer RNA biogenesis [BR:lmy03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    LM5923_0970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoU_methylase
Motif
Other DBs
NCBI-ProteinID: ADB70814
Position
974882..975391
Genome map
AA seq 169 aa AA seqDB search
MPNHIVLYQPEIPANTGNISRTCAGTDTYLHLIRPLGFSTDDKMLKRAGLDYWDNVKLSY
YDSLDEFFEKNEGGEFYYITKFGRHVYSDINYSDTNKDYFFVFGKETTGLPDALLQENEE
NCLRIPMTDHIRSLNLSNTAAILAYEALRQQNFGALLQEPNYDRKIFQD
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaccatatcgtactataccaaccagaaataccagcgaataccggaaatatctcc
agaacatgtgccgggacagatacttacttacatttaatccgtccacttggtttttcaaca
gacgataaaatgttaaaacgtgctggacttgattactgggataacgtgaaactttcctat
tacgattctctagatgaattcttcgagaaaaatgaaggcggagaattttattacattacc
aaatttggtcgtcatgtttatagcgatatcaattatagtgatacaaacaaagattatttc
ttcgtttttggaaaagaaacgactggattgccagatgcgcttttacaagagaatgaagaa
aattgtttgcgtattccaatgactgaccatattcgttcattgaatttatctaatacagca
gcaattttagcttatgaagcgttacgtcagcagaattttggtgcacttttacaagaaccg
aattacgatcgaaaaatttttcaagactaa

DBGET integrated database retrieval system