KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0971Help
Entry
LM5923_0971       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
  KO
K19285  FMN reductase (NADPH) [EC:1.5.1.38]
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Pathway
lmy00740  Riboflavin metabolism
lmy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    LM5923_0971
Enzymes [BR:lmy01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.38  FMN reductase (NADPH)
     LM5923_0971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase ROK
Motif
Other DBs
NCBI-ProteinID: ADB70815
Position
975404..976144
Genome map
AA seq 246 aa AA seqDB search
MNQAIDAILGHYSVRKFEDKDLTEEALTLLIKSAQAASTSSFVQAYSIIGITDKDIREQI
SAIAGNQPYTVQTGQLFIFVADLARHHAILEEHQVDTAALETSEKWLVSVIDAALAAQNM
AIAAESLGLGICFIGGIRNDVEQIAEILDLPPYTMPLFGLTIGHPVANKEKAKPRLPQDL
VYHENSYQKMNPETLAEYDKQIKTYYNERTAGKRVEGWSEQIARGLGRPSRLDLKAFLEK
QHLNQK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggcgatagatgccattctgggacattactcagtgcgaaaatttgaagacaag
gacttaacggaagaagcgttgaccttacttatcaagagtgcacaagccgcatctacatcc
agttttgttcaagcatactccatcatcggaataacagataaagatattcgggaacaaatc
tcagccattgcaggaaatcaaccatatacagtacaaactggacaactatttattttcgtt
gctgatttagctcgtcatcacgccatcttagaagaacaccaagtagacacagcggcactg
gaaacttcagaaaaatggcttgtttccgtcatagatgcggcacttgctgcgcaaaatatg
gctatcgcggcagaatcattaggacttggtatttgctttattggcggtattcgtaacgat
gtcgaacaaatcgccgaaatactggatttaccaccatatacgatgccgttatttggtcta
acaattggtcatccagttgctaacaaagaaaaagcgaaaccgagattacctcaagatttg
gtatatcacgaaaatagttaccaaaaaatgaatccagaaactttagcagaatacgataaa
caaataaaaacttactacaatgaacgaacagcaggtaaacgagtagaaggctggtccgaa
caaattgcccgcggacttggaagaccaagccgtttagatttaaaagcatttttagaaaaa
caacatttaaatcaaaaataa

DBGET integrated database retrieval system