KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0973Help
Entry
LM5923_0973       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
  KO
K01104  protein-tyrosine phosphatase [EC:3.1.3.48]
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LM5923_0973
Enzymes [BR:lmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     LM5923_0973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LMWPc
Motif
Other DBs
NCBI-ProteinID: ADB70817
Position
complement(976443..976901)
Genome map
AA seq 152 aa AA seqDB search
MVKVVFVCLGNICRSPMAEGLFRKEVANAGLTDEIKIDSAATGTWNLGKPPHRGTKEVLK
KHGVDYQAMRARKISDADFKEADFIIGMDQQNLADLNALNNNPDVIIRSLMSFVSGQEDK
DIPDPYYTGDFDETERMVTEGVKALLTYITKK
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
ttggtaaaagtagtttttgtatgtttaggaaatatttgtcgttcccccatggctgagggg
ttatttcgaaaagaagtggctaatgctgggctgacggatgaaataaagattgattctgca
gcaactggaacgtggaatttaggtaagccgccacatcgcgggacgaaggaagtattgaaa
aagcatggtgttgattaccaagcgatgcgtgctcgaaaaatttctgatgctgattttaaa
gaagcagattttattatcgggatggatcagcaaaatttagctgatttaaatgcccttaat
aacaatccagatgtaatcattcgttcgctgatgtcttttgtctcaggtcaagaagataaa
gatatccccgacccttattatactggtgattttgatgaaaccgagcgcatggtaactgag
ggagtgaaagctcttttaacctatattacaaaaaaatag

DBGET integrated database retrieval system