KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0977Help
Entry
LM5923_0977       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
  KO
K04079  molecular chaperone HtpG
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Brite
Protein phosphatases and associated proteins [BR:lmy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     LM5923_0977
Chaperones and folding catalysts [BR:lmy03110]
 Heat shock proteins
  HSP90
   LM5923_0977
Membrane trafficking [BR:lmy04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    LM5923_0977
Proteasome [BR:lmy03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    LM5923_0977
Mitochondrial biogenesis [BR:lmy03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    LM5923_0977
Exosome [BR:lmy04147]
 Exosomal proteins
  Proteins found in most exosomes
   LM5923_0977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c_3 HATPase_c HSP90
Motif
Other DBs
NCBI-ProteinID: ADB70821
Position
complement(979736..981541)
Genome map
AA seq 601 aa AA seqDB search
MENYSHRFQVNLAGMIDILSNHLYDEKDVYIRELLQNATDAIRARKKIDSTLEGKIHASL
TGDNNEKTLIVEDNGIGLTEDEVHAFLATIANSSKGEKNFDGESSNDFIGRFGIGLLSCF
IVSDEIVMISTSQKDGGTTEWRGKADGTYSVRKIETDTREPGTQVYLRLRAGLEDHPECE
DVEYLINTLKKYGSSLESNIIVEMNGLEEEINSWTKQFSDKETLSTLSREQIIQYGEYIL
GTHFQDYFLIENESGRTFGIAYMIPHAVQMNAIRKNTVFLNKMFVTSEANNILPDWSFFA
KCVIWTDELQPVASREAFYKNERLTSVASELGVALKKGIETLPEEALMKLLATHYLGFKA
LASEDAPFLKLIYPYLPVRTLNGEEKLGDIIAKNDVIYYTYSVDDFRQIKDIARSSGMTL
INGGYSYDSPFLAQLSYFVEGTEFVLIQPEEMTDKLRPMTADEKQAYQPILTEMNSMMAE
FDTDVLIKHFEPKDLPIIFIHSTATQELRELERAVEETTSVFSDILESIQKEQEPAPLAH
LYLNLDNELIKRLFTSGKTVKELSVIVNVLYIQALLLGHYPLKRKEMVLMNQNMLRILEM
L
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattattctcaccgctttcaggtgaacttggctggtatgattgacattctctca
aaccacctttatgacgaaaaagatgtttatattcgcgaattgctgcaaaatgcaaccgat
gccattcgtgctaggaaaaaaattgattcaactttagaaggtaaaatccatgcatctcta
actggagataataatgaaaaaacattaattgtagaagacaacggcattggtttaacggaa
gatgaggttcacgcttttctagctactattgctaattcatcaaaaggcgaaaaaaacttt
gatggagaaagttccaatgactttattggtcgttttgggattggtttactttcttgtttt
atcgtgagtgatgaaattgtaatgatttctacctctcaaaaagatggcggcacaaccgag
tggcgcggaaaagcggatggtacttattccgttcgcaagatagaaactgacactcgcgaa
ccaggtacgcaagtgtatttacgtttacgcgccggtttagaagatcatcctgaatgtgag
gacgtcgaatatttaatcaatacactgaaaaaatatggttcctctttggaaagcaatata
atagtagaaatgaatggtttagaggaagaaattaatagttggaccaaacagttttctgat
aaagaaaccttgtcaacactttcgagagaacaaattattcagtacggcgaatatatcctt
ggaacgcatttccaagactatttcttaattgaaaatgagtcaggaagaacgtttggtatt
gcttatatgattccacatgctgttcaaatgaatgctatccgaaaaaatacggtatttcta
aataagatgtttgtcaccagtgaagcaaataatattttaccagattggtcattttttgct
aaatgcgtgatttggacggatgaacttcaacccgttgcttcccgtgaagcattttataaa
aatgagcggttaactagtgttgcaagtgagcttggcgttgctttaaaaaaaggaattgaa
actcttccggaagaagcgctgatgaaattattagctacacattatcttggttttaaagca
cttgcgagtgaagatgcaccatttttaaaattaatttatccttatcttccagttcgaact
ttaaatggcgaagaaaaattaggtgatattatcgctaaaaatgacgtcatctattacact
tactcggtcgatgattttagacaaattaaggatattgcgagatcaagcggcatgacactt
attaatggtggttattcctacgactcgccatttttagcgcagttaagttattttgtggaa
ggaactgaatttgttttaatccagccggaagaaatgacggataaattacgtccaatgaca
gcggatgaaaaacaagcgtaccaacctattttgacagaaatgaatagtatgatggctgag
tttgacaccgatgtgttaatcaaacattttgagccaaaagatttaccaattattttcatc
cattctacggcaacacaagagttacgcgaactagaacgcgcagtagaagaaacaacttcc
gtattcagtgatattttagagagcattcaaaaagaacaagaacctgccccgctcgctcac
ttgtatttaaatttagataatgagctgattaaaagacttttcacttctggaaaaacagtg
aaagaattgtccgtaattgtgaatgtactttatatccaagccttactattagggcattat
ccgcttaaacggaaagaaatggtattaatgaaccaaaatatgttacgaatcttagagatg
ctatag

DBGET integrated database retrieval system