KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0979Help
Entry
LM5923_0979       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-S_biosyn
Motif
Other DBs
NCBI-ProteinID: ADB70823
Position
982447..982749
Genome map
AA seq 100 aa AA seqDB search
MNIEVTDQANKWFHDEFDVANGNGIRLFAKYGGSNSSLHPGFSIGLTAEKPQEAAVAEKK
EDLIFFIEDHDYWYFKDHDWKIDYEPKTEEVLFSFKEKVK
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcgaggtaacggaccaagcaaataaatggtttcatgatgagtttgatgtagct
aatggtaatggaattcgactttttgcgaaatacggtggttctaacagttccttgcatcct
ggtttctctatcggtttaactgccgaaaaaccgcaagaagcagctgtagctgagaagaaa
gaagacttaattttcttcattgaagatcatgattattggtatttcaaagaccacgactgg
aaaatcgactatgaaccaaaaacggaagaagtactcttttcctttaaagaaaaagtgaaa
tga

DBGET integrated database retrieval system