KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0982Help
Entry
LM5923_0982       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
  KO
K03449  MFS transporter, CP family, cyanate transporter
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lmy02000]
    LM5923_0982
Transporters [BR:lmy02000]
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Cyanate porter (CP) family [TC:2.A.1.17]
    LM5923_0982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-ProteinID: ADB70826
Position
complement(984429..985646)
Genome map
AA seq 405 aa AA seqDB search
MNSDLTNKKILTRSSKVMLVLGIVLIAANLRTPITSVGPLLGMIQSDLHLTNTMAGLLTT
IPLLAFAGLSPFVSKLSRALGMEVLILVALLTLVLGSLLRPFGGELNLFAGTFMIGLAIA
VGNVILPSLIKKEFPFKLGLMTGVYSISMNLCAAIAAGLTVPIAMNNRFSWHGSMVFWAI
LGIVALVIWLTQLKYNQRSTEKIATHLVTTSVWKSPLAWKISLFMGSQSAIFYISIAWLP
NILADQGLSSTSSGLMLSLMQFAVMPITFIIPIIAGRMKNQQLLVGISILFFLIGIFGIM
FASGSVLILSIAIIVYGIGSGMSFSLSMMFFNLRTTSATESADLSGMAQSIGYLFAASGP
ILFGTLHDALGSWQPTLYVLVGITLLMLYCGLDAGRNKFLFPQKK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagatttaaccaataaaaaaatccttacacgttcgagtaaggtaatgcttgtt
ttaggaattgttttaattgcggcaaacttacgtacacctattacctctgtaggtccgtta
cttggaatgattcaatcagatttacatttaaccaatacaatggctggattactaacaacg
attccgctacttgcatttgcgggactatccccatttgtttctaaactaagtcgagcactt
ggtatggaagtattaattttggtagcacttttgacacttgtacttggtagcttacttcga
ccttttggtggcgaacttaatttatttgctggaacgtttatgattggccttgctatcgca
gtcggaaatgtcattttgccaagtttgataaaaaaagaatttccatttaaattgggtcta
atgactggagtttattccatttcgatgaatttgtgtgcagcaattgcagctggcttaacg
gttccaattgctatgaacaatcgctttagctggcatggaagtatggttttctgggcaatt
cttggaatcgttgctttagtcatttggcttacacagttaaaatataatcaacgctcgaca
gaaaaaattgcgactcacttagttacaacttcggtttggaagtctccgcttgcgtggaaa
atttctttatttatgggttcgcagtcagcaattttttatatttcgattgcctggttacca
aatattttagcagaccaagggttatctagtacttctagtggtttaatgctttccttaatg
cagtttgcggttatgccgattacgtttattattcctattattgccggacgaatgaaaaat
cagcaattacttgttggaatttctattttattctttttaattgggatttttggcattatg
tttgcttctggtagcgtgcttattttatcaattgctatcattgtatacggaattggttcg
gggatgtcgtttagtttatcgatgatgttctttaatttgcgaacaacaagcgcgacagaa
tcagcggatttatctggaatggcacaatctatcggttacttatttgccgcctctggtcca
atattatttggtaccctacacgatgcgcttggtagttggcaaccaaccttatatgtttta
gtcggtattaccctgcttatgctatactgcggcctagatgctggacgcaataaatttctt
tttccacagaaaaagtga

DBGET integrated database retrieval system