KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0987Help
Entry
LM5923_0987       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4064 PMP22_Claudin
Motif
Other DBs
NCBI-ProteinID: ADB70831
Position
989408..989866
Genome map
AA seq 152 aa AA seqDB search
MIKRTGEIVLAIIGLVLSLLAQAFIAIIGLLMISGSKGKEGLTTFYNNYYKTMTEWEIPK
KEVPDPDRVLDFVQTLSWTALTGGLITLALGIFGIYYIFKNKKPVFAGYLFLAAGVVSLL
STALISFIPALLFIVAAILCFVRKPKSAFSGL
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgattaaacgaactggtgagatagtactcgctattattggtcttgttttaagtctactc
gcacaagcatttattgctattattggtctattaatgataagcggttcaaaaggaaaggaa
ggtttaacaactttctacaacaactactacaaaacaatgactgaatgggaaatcccgaaa
aaagaggttcctgatcccgatcgtgtattggattttgtgcaaacattatcttggacagca
ttaacgggaggcttaattacgctcgctctaggtatctttgggatttactacatcttcaaa
aataaaaaaccagtttttgcaggatatttatttttagcagcaggcgttgtatcgttgctt
tctacagcactaattagtttcattcctgcgttactattcattgttgctgctatactttgt
tttgtccgcaaaccgaagagcgctttttctggattataa

DBGET integrated database retrieval system