KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0989Help
Entry
LM5923_0989       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Orf78
Motif
Other DBs
NCBI-ProteinID: ADB70833
Position
990420..990734
Genome map
AA seq 104 aa AA seqDB search
MRAILIGVLIILLIAMILIVLLPAILAMVGAVLGFWSLKKLLEARSVGEKVIYGVLIGVG
ALIILANLKGILVVVIIGAIIYFLTRNKNKPRKNDDVFDYPYNK
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgagagcaatattgattggcgtattaataattttactaattgcgatgatacttatagtc
ttattgccagcgatactagcaatggttggtgcagtgctcggcttttggtcacttaagaaa
ctacttgaagcaaggtccgtaggtgaaaaagttatttatggagttctaattggcgttggt
gccttaataattctagctaacttaaaaggaattctggttgttgtaattatcggagcaatc
atttacttcctaactagaaataaaaataaaccaagaaaaaatgatgacgtattcgactac
ccatacaataaataa

DBGET integrated database retrieval system