KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0998Help
Entry
LM5923_0998       CDS       T01164                                 

Definition
(GenBank) heat shock protein HtpX
  KO
K03799  heat shock protein HtpX [EC:3.4.24.-]
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Brite
Enzymes [BR:lmy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     LM5923_0998
Peptidases [BR:lmy01002]
 Metallo Peptidases
  Family M48: Ste24 endopeptidase family
   LM5923_0998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M48 Peptidase_M56 Yip1 NnrS TolA DUF898
Motif
Other DBs
NCBI-ProteinID: ADB70842
Position
998475..999389
Genome map
AA seq 304 aa AA seqDB search
MLFEQIAANKRKTIFIILGFFIFVLMVGAAIGIIVWNNYLNGLVLAAVIGAFYILIMVMS
SSSVVMAMNHAKEVTSKEQAPVLWDTVESMAMVAGIPMPKVYIVEDPSPNAFATGISPEK
GAVAVTRGLLNKLERYELEGVIAHEISHIRNYDIRLSTIAIALVAVIAILSDIAMRMIFW
GSLTGGRNNRKSDNNNSGGAQAIIYIVALIFVILAPIIATAIQFALSRNREYLADASAVE
LTRNPDGLIQALQKISGDSKKMEEVSASSESIYFSSPLKSKKNKPGLFDSHPPISSRIER
LENM
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgctatttgaacaaattgcagcaaataagcgaaaaacaatttttattattcttggcttt
ttcattttcgttcttatggttggcgctgctataggtataattgtttggaataactatctg
aatgggcttgtactcgcggctgttattggtgcattttatattttgattatggtaatgagc
agttcgtcggtcgttatggcgatgaatcatgcgaaggaagtcacatcaaaagaacaagcg
ccagttttgtgggataccgttgaaagtatggcaatggttgctggtattccgatgccaaaa
gtatatatcgttgaagatccaagtccgaacgcttttgcgacggggatttctcctgaaaaa
ggagccgtggcggttactagaggattgcttaataaattagaacgttatgaacttgagggc
gttattgcgcatgaaatttctcatattcgtaattatgatattcggttatcaacgatcgcc
attgcgctagtggctgttattgcgattcttagtgatatagcaatgcgaatgattttctgg
ggaagcctaactggtggcagaaataaccgtaaaagtgacaataataacagtggcggggca
caagcgattatctatatcgttgcactcatatttgttattttggcgcctattattgcaaca
gctattcaatttgcgttatctcgtaatagagagtatttagctgatgctagtgcggtagaa
ttaaccagaaatccagatggacttatccaagctttacaaaaaatcagtggtgattcgaaa
aaaatggaagaagtgagtgcttctagtgagtccatttacttttcgtcacctctaaagtca
aaaaaaaataagccaggtctttttgactcacatccgccaattagttcgcggattgaacgc
ttagaaaatatgtaa

DBGET integrated database retrieval system