KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_1455Help
Entry
LM5923_1455       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Pathway
lmy00900  Terpenoid backbone biosynthesis
lmy01100  Metabolic pathways
lmy01110  Biosynthesis of secondary metabolites
lmy01130  Biosynthesis of antibiotics
Module
lmy_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:lmy00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LM5923_1455
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:lmy01006]
    LM5923_1455
Enzymes [BR:lmy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     LM5923_1455
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     LM5923_1455
    2.5.1.29  geranylgeranyl diphosphate synthase
     LM5923_1455
Prenyltransferases [BR:lmy01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   LM5923_1455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: ADB71296
Position
1421626..1422507
Genome map
AA seq 293 aa AA seqDB search
MQDLTLFLEQYKKVIDESLFKEINERNIEPRLKESMLYSIQAGGKRIRPMLVFATLQALK
VNPLLGVKTATALEMIHTYSLIHDDLPAMDNDDYRRGKWTNHKVFGDATAILAGDALLTL
AFSILAEDDNLSFETRIALINQISFSSGAEGMVGGQLADLEAENKQVTLEELSSIHARKT
GELLIYAVTSAAKIAEADPEQTKRLRIFAENIGIGFQISDDILDVIGDETKMGKKTGADA
FLNKSTYPGLLTLDGAKRALNEHVTIAKSALSGHDFDDEILLKLADLIALREN
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagatttaaccctttttttagaacaatataaaaaagtgattgatgagtcgcttttt
aaagaaataaacgagcgaaatatcgaacctagactaaaagagtccatgttatattctatt
caagcaggcgggaaacggattcgtccaatgctagttttcgctacgcttcaagctttaaaa
gtaaatccgcttttaggtgtaaaaaccgcaacagcgttagaaatgattcacacatacagc
cttattcatgatgatctaccagcaatggataacgatgattatcgtcgaggcaagtggact
aatcataaagtttttggcgatgcaactgcgattttggcaggagatgctttactaacgctc
gctttttctattttagctgaagacgataatttatcttttgagacacgcattgctttgatt
aaccaaattagttttagtagcggtgcagaaggaatggttggtggtcaacttgcagacttg
gaagcggaaaacaaacaagtgacgctagaagagttatcatccattcatgcacgaaaaacg
ggtgaattattaatttatgctgtaacctctgcagcaaaaattgcggaagctgatccagaa
caaacgaaacgcttacgaatttttgcagagaatattgggattggatttcaaattagcgac
gatattttagatgtaattggtgatgaaacgaaaatgggtaaaaagacaggggccgacgct
tttctgaataaaagtacctatcccggattactcacgcttgatggggcaaaaagggcatta
aatgagcatgttacgattgcaaagtcagcgctttcagggcatgatttcgatgatgaaatt
ctcttgaaacttgctgatttaatcgcacttagagaaaattaa

DBGET integrated database retrieval system