KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_1507Help
Entry
LM5923_1507       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Pathway
lmy00071  Fatty acid degradation
lmy00072  Synthesis and degradation of ketone bodies
lmy00280  Valine, leucine and isoleucine degradation
lmy00310  Lysine degradation
lmy00362  Benzoate degradation
lmy00380  Tryptophan metabolism
lmy00620  Pyruvate metabolism
lmy00630  Glyoxylate and dicarboxylate metabolism
lmy00640  Propanoate metabolism
lmy00650  Butanoate metabolism
lmy00900  Terpenoid backbone biosynthesis
lmy01100  Metabolic pathways
lmy01110  Biosynthesis of secondary metabolites
lmy01120  Microbial metabolism in diverse environments
lmy01130  Biosynthesis of antibiotics
lmy01200  Carbon metabolism
lmy01212  Fatty acid metabolism
lmy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LM5923_1507
   00630 Glyoxylate and dicarboxylate metabolism
    LM5923_1507
   00640 Propanoate metabolism
    LM5923_1507
   00650 Butanoate metabolism
    LM5923_1507
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LM5923_1507
   00072 Synthesis and degradation of ketone bodies
    LM5923_1507
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LM5923_1507
   00310 Lysine degradation
    LM5923_1507
   00380 Tryptophan metabolism
    LM5923_1507
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LM5923_1507
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LM5923_1507
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LM5923_1507
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmy04147]
    LM5923_1507
Enzymes [BR:lmy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LM5923_1507
Exosome [BR:lmy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LM5923_1507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADB71348
Position
complement(1479570..1480739)
Genome map
AA seq 389 aa AA seqDB search
MKEVVIIDAVRTPIGKFGGSLKDISAVDLGATALKGVLERANIAPKRVDQVIFGNVLQAG
LGQNVARQIAIKAGIPYKVPGVTINEVCGSGLKSVMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEINPKKLRNSMLIDGLTDVYGEYHMGITAENVAEKFSVTREEQDEFAH
NSQMKAASTQEKKLFEEEIIPVKLPDGSFFEADETIRANSTLEKLATLKSVFKEGGTVTA
GNASGINDGASAIILMSKEKAVAENIPYIATIKVTSEVGVNPALMGYAPYYAVNEALTKG
GYSIDEIDLFHLNEAFASQSVAVARDLKIPEEKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHIGVASLCVGGGIGIAIILERA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttataatagatgcagttagaacaccaattggaaaattcggtggtagt
ttgaaagacatcagtgcagtagatcttggtgctaccgctctaaaaggtgttttagaaaga
gccaatattgctccaaaacgtgtggatcaagtaatttttggtaatgtattacaagctgga
cttggccaaaatgtagctagacaaatcgctattaaagcaggaattccttataaagtaccc
ggagtcacaatcaatgaagtgtgtggatctggcttaaaatcggttatgcttggcagacaa
gcaattcaactaggggaagctgacatcgtagcagtaggagggaccgaaaatatgtcccaa
gcaccacttttacttaatcccgagctagccggtgaagaaatcaatccaaaaaaactaaga
aatagcatgttaattgatggtttaacagatgtttacggcgaatatcacatgggaattact
gcagaaaatgttgcggaaaaattctccgtaacccgagaagaacaagatgaatttgctcat
aactctcaaatgaaggccgcaagtacacaagaaaaaaaactttttgaagaagaaattatt
cctgtaaaacttccagacggttcattttttgaagccgatgaaacgattcgcgcgaattca
actctagaaaaattagctacgttgaaaagcgtattcaaagaaggtggaactgttacagcc
ggtaatgcttccggtatcaatgatggagcttccgcaattattttaatgtcgaaagaaaag
gcagtcgcggaaaacattccttatatcgcaacaatcaaagtaacctctgaggttggtgtc
aatccagcacttatgggttacgcgccatactatgcagtaaatgaagctttaactaaaggt
ggatattctatcgatgaaattgatttattccatttaaacgaagcttttgcatcgcagtct
gttgcagtggctcgtgatttgaaaattcccgaagagaaacttaatatttacggtggagca
attgcgctaggtcatccaatcggagcttccggcgcacgcattattgcctctttgttaaat
gaattaaaacatgaaaacaagcatatcggggtagcttccttgtgcgttggtggtggtatt
ggcattgcaattatccttgaaagagcatga

DBGET integrated database retrieval system