KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_1652Help
Entry
LM5923_1652       CDS       T01164                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Pathway
lmy00860  Porphyrin and chlorophyll metabolism
lmy01100  Metabolic pathways
lmy01110  Biosynthesis of secondary metabolites
lmy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LM5923_1652 (hemB)
Enzymes [BR:lmy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     LM5923_1652 (hemB)
Exosome [BR:lmy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LM5923_1652 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD Metallophos_3
Motif
Other DBs
NCBI-ProteinID: ADB71493
Position
complement(1627439..1628413)
Genome map
AA seq 324 aa AA seqDB search
MKNQFDRHRRLRKTKTMRDLVRETVLHTDDLIYPIFVKDGKEPKTEVVSMPGVFQYPLHE
LEEEMRVVESLGIKAVILFGIPAEKDAVGTQAYHDHGIIQEATRLIKKSFPEILVVADTC
LCEFTDHGHCGVIENGEILNDESLELLKQTAVSQAAAGADIIAPSNMMDGFVQVIREGLD
EAGFYDIPIMSYAVKYASAFYGPFRDAAGSAPQFGDRKSYQMDPANREEALREAKSDEQE
GADFLIVKPSLSYLDIMRDVKNNTNLPVVAYNVSGEYAMVKAAAQNGWIDEEKIVIEMLT
SMKRAGATLIITYFAKDVSKYLNK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaatttgatagacatcgtcgtctaagaaaaaccaaaacaatgcgtgattta
gtaagagaaacagttttacatacagatgatttaatctatccgatttttgttaaagatggc
aaagaaccaaaaacagaagtagtttctatgcctggggtttttcaatatcctttacatgaa
ttagaagaagaaatgcgcgtagttgaaagtcttggtattaaagcggttattttatttggc
attcctgccgaaaaagacgcagttggtacgcaagcttatcacgaccacggaattattcaa
gaagctacaagacttattaaaaaaagttttcctgaaattcttgtggtggctgacacttgt
ttatgtgaatttactgatcatggacattgtggtgttattgaaaacggtgaaattctcaat
gacgaatcgcttgaattattgaaacaaacagctgtcagtcaagccgcagcaggagcggat
atcattgctccatctaatatgatggatggttttgttcaagtcattcgcgaagggttagat
gaagctgggttttatgatatcccaattatgtcttatgctgttaaatatgcttctgctttt
tacggaccgttccgtgatgctgctggcagtgcacctcaatttggtgataggaaatcttat
caaatggatcctgccaatcgtgaagaagctcttcgcgaagcaaagtcggatgaacaagaa
ggcgcagattttcttattgtaaaaccatcattatcttacttagatatcatgcgcgacgtt
aagaataataccaatttaccagtagttgcctacaatgttagtggtgaatatgcaatggta
aaagcagctgcgcaaaatggttggatagacgaagaaaaaattgttatagaaatgctaact
agtatgaaacgagcgggtgcaacacttatcattacttattttgcaaaagatgtatctaaa
tacttaaataaatag

DBGET integrated database retrieval system