KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_2601Help
Entry
LM5923_2601       CDS       T01164                                 

Gene name
tpi
Definition
(GenBank) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Pathway
lmy00010  Glycolysis / Gluconeogenesis
lmy00051  Fructose and mannose metabolism
lmy00562  Inositol phosphate metabolism
lmy01100  Metabolic pathways
lmy01110  Biosynthesis of secondary metabolites
lmy01120  Microbial metabolism in diverse environments
lmy01130  Biosynthesis of antibiotics
lmy01200  Carbon metabolism
lmy01230  Biosynthesis of amino acids
Module
lmy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lmy_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LM5923_2601 (tpi)
   00051 Fructose and mannose metabolism
    LM5923_2601 (tpi)
   00562 Inositol phosphate metabolism
    LM5923_2601 (tpi)
Enzymes [BR:lmy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LM5923_2601 (tpi)
Exosome [BR:lmy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LM5923_2601 (tpi)
  Exosomal proteins of bladder cancer cells
   LM5923_2601 (tpi)
  Exosomal proteins of melanoma cells
   LM5923_2601 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADB72442
Position
complement(2608588..2609343)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTAAKAGQFAEDVKNNVPSSDAVESVVAAPALFLQELVRLTEGTNLR
VSAQNCYFEDEGAFTGEISPFALADLGVSYVIIGHSERREYFHETDEDINKKAHAIFKHG
MTPIICCGETLDQREAGQTDTWVRGQIRAALAGLTEEQVIKSVIAYEPIWAIGTGKSSTS
ADANETCAVIRAEVADAVSQKAADAVRIQYGGSVKPENIADYLAESDIDGALVGGASLEP
ASFLALLEAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattattgctggtaactggaaaatgaacaaaactgctgcaaaagcagga
caatttgcagaagacgtaaaaaataacgtgccatcaagcgatgctgttgaatcagtagtt
gctgcaccggctctatttttacaagaattagttcgtcttactgaaggaactaatcttcgt
gtgtctgcacaaaactgttattttgaagacgaaggtgctttcactggcgaaattagcccg
tttgcacttgctgacttaggcgtttcttatgttattatcggacactctgaacgtcgtgag
tacttccacgaaacagacgaagatattaacaaaaaagcacatgcaatcttcaaacacggc
atgacaccaatcatttgctgtggtgaaacattagatcaacgtgaagctggtcaaacagat
acttgggtacgtggtcaaatccgtgcagctcttgctggattaacggaagaacaagtaatc
aaatctgttattgcttatgaaccaatttgggcaatcggtactgggaaatcttctacaagt
gctgatgcaaacgaaacttgtgcagttattcgtgcagaagttgctgacgctgtatctcaa
aaagcagcagacgcagttcgtattcaatacggcggtagcgtaaaacctgaaaacattgct
gattatcttgcagagtccgacattgacggcgctcttgtaggtggagcaagcttagaacca
gcatcgttcttagcattattggaggcagtaaaataa

DBGET integrated database retrieval system