KEGG   Listeria monocytogenes serotype 7 SLCC2482: LMOSLCC2482_1623Help
Entry
LMOSLCC2482_1623  CDS       T02221                                 

Gene name
citC
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
lmz  Listeria monocytogenes serotype 7 SLCC2482
Pathway
lmz00020  Citrate cycle (TCA cycle)
lmz00480  Glutathione metabolism
lmz01100  Metabolic pathways
lmz01110  Biosynthesis of secondary metabolites
lmz01120  Microbial metabolism in diverse environments
lmz01130  Biosynthesis of antibiotics
lmz01200  Carbon metabolism
lmz01210  2-Oxocarboxylic acid metabolism
lmz01230  Biosynthesis of amino acids
Module
lmz_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:lmz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LMOSLCC2482_1623 (citC)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LMOSLCC2482_1623 (citC)
Enzymes [BR:lmz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     LMOSLCC2482_1623 (citC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: CBY04144
Position
complement(1622768..1624030)
Genome map
AA seq 420 aa AA seqDB search
MSQKIQVENGVLKTPNNPVIPFIEGDGTGPDIWAAAKRVLDAAVKKAYNGEKEIAWKEVL
AGEKAFKQTGEWLPQATLDTIDEYLIAIKGPLTTPIGGGIRSLNVALRQELDLYVCLRPV
RYFKGVPSPVKRPEDTDMVIFRENTEDIYAGIEFKEGSEESKKLIDFLKSEFGVDKIRFP
ETSGIGIKPISKEGTERLVRSAIEYAIKEGRKSLTLVHKGNIMKFTEGAFKNWGYDLCER
EYGDKVFTWNEYDRIKEAEGTEVADAKQKEALAAGKILVKDSIADIFLQQILTRPAEFDV
VATMNLNGDYISDALAAQVGGIGIAPGANINYLTGHAIFEATHGTAPKYAGLDKVNPSSV
ILSGTLLLEHIGWGEAAALINQSMEKTIAAKTVTYDFARLMDGATEVKCSEFADELIKNF
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaaaattcaagtagaaaacggtgtgctcaaaacaccaaacaacccagtcatt
ccttttattgaaggggacggaactggtccagacatctgggcagctgcaaaacgcgtttta
gatgccgcagtaaaaaaagcttacaatggcgaaaaagaaattgcttggaaagaagtacta
gctggtgaaaaagcatttaaacaaacaggagaatggttaccacaagcgactttagataca
attgatgaatatttgattgctattaaaggaccgcttactactccaatcggtggaggcatt
cgttcgttaaacgttgccctgcgccaagagttagatttatatgtttgtttacgtccagtt
cgttatttcaaaggcgttccttcaccggtgaaacgtccggaagacacagatatggtcatt
ttccgtgagaatacagaagatatatatgcagggattgaatttaaagaaggcagcgaagaa
tcaaaaaaactaatcgacttcttaaaatctgagtttggcgttgacaaaattcgtttcccg
gaaacttctggtattggtattaagccaatttccaaagagggaacagagcgtttagtgcgt
tcggcgattgaatatgcaattaaagaaggtcgtaaatcattaacgcttgtacacaaaggg
aatatcatgaaattcacagaaggagctttcaaaaattggggctatgacttatgtgaacgc
gaatatggcgataaagtatttacttggaatgagtatgatcgcattaaagaagcagaagga
acagaagttgctgatgcgaaacaaaaagaagcgcttgctgctgggaaaattttagtcaaa
gattcgattgcggatattttcttgcaacaaatcttaactcgcccggctgaatttgatgta
gttgctacaatgaacttgaatggagattacatttctgatgcacttgctgctcaagtaggc
ggaatcggtattgctccaggagcaaacattaactacttaactggccatgcaattttcgaa
gcgacgcatggtactgcaccgaaatatgcaggtcttgataaagtgaatccttcatcagtt
attttatctgggacacttcttcttgaacatattggttggggtgaagcggctgcattaatt
aatcagtcaatggaaaaaacaatcgctgcgaaaaccgtaacttatgattttgctcgatta
atggatggtgcgacagaagttaaatgttcggaatttgcagatgaattaataaaaaatttc
taa

DBGET integrated database retrieval system