KEGG   Listeria monocytogenes serotype 7 SLCC2482: LMOSLCC2482_1887Help
Entry
LMOSLCC2482_1887  CDS       T02221                                 

Gene name
coaBC
Definition
(GenBank) bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate-cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
lmz  Listeria monocytogenes serotype 7 SLCC2482
Pathway
lmz00770  Pantothenate and CoA biosynthesis
lmz01100  Metabolic pathways
Module
lmz_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:lmz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    LMOSLCC2482_1887 (coaBC)
Enzymes [BR:lmz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     LMOSLCC2482_1887 (coaBC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     LMOSLCC2482_1887 (coaBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein NAD_binding_7 Pyr_redox_2 Usp
Motif
Other DBs
NCBI-ProteinID: CBY04408
Position
complement(1918485..1919684)
Genome map
AA seq 399 aa AA seqDB search
MQGKNILLAVSGGIAVYKAVALTSKLTQAGANVKVMMTEHAQEFVPPLSFQVLSKNDVYT
DTFDEKKSSVVAHIDLADWADLVIVAPATANVIGKMANGIADDMVTTTILASEAPVWVAP
AMNVHMIQHPAVIRNINRLYADGVRFIEPEEGYLACGYVGRGRLEEPEKIVLRIAEFFQE
DKDLLRDKNVLVTAGATREKLDPVRYFTNHSTGKMGFSIAESAARHGAKVTLVTTSKALP
VPPGVEAIYVESAEEMYQAVDEHKVSQDIFVMTAAVADYTPAKVSDQKIKKQPGDFAIEM
KRTKDILLEIGQHKTADQVVIGFAAETENLEANARKKLTSKNADMIVANNISVAGAGFSG
DTNIVTFYRKDGSSKALPILDKKEVAEHIIKETANFLRK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggaaaaaatatcttactcgcagtgtccggtggcattgctgtttataaagcagtc
gcacttacaagtaaattaacgcaagcaggagcaaacgtcaaagtgatgatgacagaacat
gctcaggaatttgttccaccgctttcgtttcaagtattatctaaaaatgatgtatacaca
gatacatttgacgaaaaaaaatcaagtgttgtcgcacatatcgatttagctgattgggcc
gatttagtaattgtcgcaccagctaccgcaaatgtgattggcaaaatggcaaatggaatc
gctgatgatatggtaacgacaaccattcttgcatcagaggcaccagtttgggtagcgcca
gcaatgaatgtccacatgattcagcacccagcagttattcggaatattaatcgattatac
gcagacggtgttcgttttatcgagccagaagaaggttacttagcttgtggctacgttggt
cgcggtcgtcttgaagaaccagaaaaaatcgttcttcgtattgctgaattttttcaagaa
gataaagatttattgcgcgacaaaaacgtgctagttacagccggcgcaactcgcgaaaaa
ttagatcctgtacgctatttcaccaaccattccacgggcaaaatgggctttagtattgca
gaatccgcagctcgtcatggtgcaaaagtgacgctcgttacgacaagcaaagcacttccc
gtaccacctggtgtagaagcaatctatgtcgaatcggcagaagaaatgtatcaagctgtg
gatgaacataaagtgtcacaagatatcttcgtgatgaccgcagcagttgccgattacacg
ccagcaaaagtatcagaccaaaaaattaaaaaacagccgggcgattttgccattgaaatg
aaacgaaccaaagatattttactcgaaattggtcaacacaaaactgcagaccaagtcgtg
attggctttgccgctgaaacagaaaatctagaagcaaacgcacgtaaaaaattaacatcc
aaaaatgccgatatgattgtcgctaacaatattagtgtggcaggagcaggcttttctggt
gatacaaatatcgtgacattttaccggaaagatggttctagcaaagcgttaccgatacta
gataaaaaagaagttgctgaacatatcatcaaagaaactgctaactttttaaggaagtga

DBGET integrated database retrieval system