KEGG   Lelliottia nimipressuralis: CWR52_00805Help
Entry
CWR52_00805       CDS       T05333                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
lni  Lelliottia nimipressuralis
Pathway
lni00052  Galactose metabolism
lni00500  Starch and sucrose metabolism
lni01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lni00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CWR52_00805
   00500 Starch and sucrose metabolism
    CWR52_00805
Enzymes [BR:lni01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     CWR52_00805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43 Reg_prop
Motif
Other DBs
NCBI-ProteinID: AVH15801
UniProt: A0A2L2J7D4
Position
168765..170171
Genome map
AA seq 468 aa AA seqDB search
MTLPSRWPAILQAVMTGQPRALADSHYPQWHAAPVTGLMNDPNGFIWFAGRYHLFYQWNP
LDCEHRFKCWGHWSSADLVHWRHEPLALMPDEAYDRNGCYSGSAVDNEGVLTLCYTGNVK
FDDGSRTAWQCLAVEQPDGTFRKLGPVLALPEGYTGHVRDPKVWQHEGMWYMVLGAQDVQ
KRGKVLLFKSADLHAWTSCGEIAGHGVNGLTDAGYMWECPDLFALDGTHVLICCPQGLER
EPHRYLNTYPATWMCGAFDYASAVFDHGELHELDAGFEFYAPQTTLAEDGRRILIGWMGV
PDGEEMLQPTRAHGWMHQMTCPRELRYRDGRLWQTPARELAALREDEQHWQGRASDAPEL
DATRLEFELGASQVNVDFAGALRLTLDEQGIRLERASLKTGETLTRYWQGDVRHLRVLCD
RSSVEIFINHGEGVMSSRYFPDHPARVRFEGASDITLRYWSLRACMIE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgacgttaccttcccgctggcctgcgatcctgcaggccgttatgacaggtcagccgcgg
gcgctggcggacagccattatccgcaatggcacgccgcgccggtgacggggctgatgaac
gacccgaacgggtttatctggtttgctggccgctatcacctgttctatcagtggaacccc
ctggactgcgagcatcgctttaagtgctggggccactggagctcagcggacctggtgcac
tggcggcatgagccgctggcgctgatgcctgacgaagcgtatgaccgcaacggctgctac
tccggtagcgccgtcgataacgagggcgttttgaccctgtgctacaccggcaacgtcaag
ttcgatgacggtagccgcaccgcctggcagtgcctggccgtcgagcagccggacggaacc
ttcaggaagctggggccggtgctggcgctgccggaaggctacaccggccacgtgcgcgac
ccgaaggtgtggcagcacgaggggatgtggtacatggtgctcggcgcgcaggatgtgcag
aagcgcggcaaggtgctgctgtttaaatcagccgatttgcacgcctggacatcctgcggg
gagatcgccggtcacggggttaacggcctgacggacgcgggctatatgtgggagtgtccg
gacctgtttgccctcgatgggacacatgtcctgatctgctgcccgcaggggctggagcgc
gagccgcatcgctatctcaatacctatccggccacctggatgtgcggggcgtttgattac
gccagcgccgtattcgatcacggcgagcttcacgagctggacgcggggtttgagttttac
gccccacaaaccacgctggcggaagatggacgccgcatcctgattggctggatgggcgta
ccggacggggaagagatgcttcagcccacccgggcgcacggctggatgcaccagatgacc
tgcccgcgcgaactacgctatcgcgacggcaggctctggcagaccccggcgcgcgaactg
gcggcgctgcgtgaagatgagcagcactggcaggggcgcgccagcgacgcacccgaactg
gacgcgacgcgtctggagtttgagctgggcgcatcgcaggtgaacgtcgattttgccggc
gcgctgcgcctcacgcttgatgagcagggtatacgcctggaacgcgcgagcctgaaaacc
ggtgaaacactgacccgctactggcagggtgacgtccgccatttgcgcgttctgtgcgac
cgctccagcgtcgaaatcttcattaaccacggcgaaggggtaatgagcagccgctatttt
cctgaccatccggcccgggtgcgattcgaaggtgcgtccgatatcacattacgctactgg
tcgctgcgcgcctgcatgatagaatga

DBGET integrated database retrieval system