KEGG   Lelliottia nimipressuralis: CWR52_01100Help
Entry
CWR52_01100       CDS       T05333                                 

Definition
(GenBank) succinate-semialdehyde dehydrogenase
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
lni  Lelliottia nimipressuralis
Pathway
lni00250  Alanine, aspartate and glutamate metabolism
lni00650  Butanoate metabolism
lni00760  Nicotinate and nicotinamide metabolism
lni01100  Metabolic pathways
lni01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CWR52_01100
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CWR52_01100
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CWR52_01100
Enzymes [BR:lni01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     CWR52_01100
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     CWR52_01100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh RmuC
Motif
Other DBs
NCBI-ProteinID: AVH15857
UniProt: A0A2L2J7S4
Position
complement(233878..235266)
Genome map
AA seq 462 aa AA seqDB search
MTYSSATHAFSVNPATGETLAAYPWATPEQVERAISQSDAGYRQWRRESVSHRAQKLRDL
GAALRHRTEEMAQTISREMGKPIQQARAEVAKSAGLCEWYAEHGPVMLRAEPTQVENQNA
VIEYRPLGPILAVMPWNFPLWQVLRGAVPILLAGNSYLLKHAPNVLGSADLIAQIFADAG
FPEGVFGWVNATNDGVSQAINDRRIAAVTVTGSVRAGAAIGAQAGAALKKCVLELGGSDP
FIVLNDADLDLAVKAAVAGRYQNTGQVCAAAKRFIVEEGIADAFTQRFVDAVGALKLGAP
DQEENYLGPMARFDLRDELHQQVQATLAEGATLLLGGEKISGEGNYYAPTVLANVTPAMT
AFRQELFGPVAAITVAKDAEHALMLANDSDFGLSATVFTADAALADKFSRELECGGVFIN
GFSASDARVAFGGVKKSGFGRELSHFGLQEFCNVQTVWKDRV
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgacttattcctctgcaacacatgccttctctgtcaacccggccacgggtgaaaccctc
gccgcgtatccgtgggcgacgccggaacaggttgaacgcgcgatttctcagtccgacgcg
ggctatcgccagtggcgtcgcgaaagcgtctcccaccgggcgcaaaagctgcgcgatctt
ggtgccgcgctgcgtcatcgcactgaagagatggcgcagacgatctcccgtgaaatgggc
aaacccattcagcaggcgcgggcagaagtggcgaaatccgctggcctgtgcgagtggtac
gccgagcacggcccggtgatgctgcgtgcggaacccacgcaggtggaaaaccagaacgcg
gttattgaataccgtccgctggggccgatcctcgcggtaatgccgtggaacttcccgctc
tggcaggtgctgcgtggcgcggtgccgattctgctggcagggaacagctatctgctcaaa
catgcgcccaacgtgctcggctcggcggatcttatcgcgcagatttttgcggatgcgggt
ttccctgaaggcgtgtttggctgggtgaacgccaccaacgacggcgtcagccaggcaatt
aacgatcgtcgtattgcggcggtgaccgtcaccggcagcgtgcgtgccggggctgccatt
ggcgctcaggcgggggccgcgctgaaaaaatgtgttcttgaactgggcggctctgacccg
ttcatcgttctcaacgatgccgacctggatcttgccgtgaaggcggcggtagcaggccgc
taccagaataccgggcaggtgtgtgcggcggccaaacgcttcattgtggaggagggcatt
gcggacgcctttacccaacgctttgtcgatgcggttggggccctgaagctgggcgcgccg
gatcaggaagaaaactatctgggcccgatggcgcgttttgatctgcgcgatgaactgcat
cagcaggtacaggcgacgctggcagaaggggcaacgctgctgctgggcggtgagaaaatc
agcggcgaggggaattattatgcgccaaccgtgctggcgaatgtcaccccggcgatgacg
gcgttccgtcaggagctgtttggtccggtcgcggccattacggtcgcgaaagacgcggag
cacgccctgatgctggccaacgacagcgattttggtctgtcagccacggtctttaccgct
gacgcagcgcttgcggataaattctcccgcgagctggagtgcggcggggtgtttatcaac
ggctttagcgccagcgatgcgcgtgtagcctttggcggcgtgaagaaaagcggctttggc
cgcgagctctcccactttggcttgcaggagttctgtaacgtgcagacggtgtggaaggat
cgcgtgtaa

DBGET integrated database retrieval system