KEGG   Lelliottia nimipressuralis: CWR52_08760Help
Entry
CWR52_08760       CDS       T05333                                 

Gene name
apaG
Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
lni  Lelliottia nimipressuralis
Brite
KEGG Orthology (KO) [BR:lni00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CWR52_08760 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AVH17285
UniProt: A0A2L2JBV4
Position
1815378..1815755
Genome map
AA seq 125 aa AA seqDB search
MIDSPRVCVHVQSVYVESQSSPDEERFVFAYTVTIRNLGRTPVQLRGRYWLITNGNGREI
EVQGEGVVGEQPHIAPGEEYQYTSGAVIETPMGTMQGHYEMVDVDGNGFRVAIPVFRLAV
TTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattgattcgccccgcgtatgtgtccatgtacaaagcgtctatgttgaatcacagtcc
tcgcccgacgaagaacgctttgtctttgcttacaccgtgaccattcgcaacctggggcgg
acgcccgtgcagctgcgcggacgctactggcttatcaccaacggcaatggccgcgaaatc
gaagttcagggggaaggtgtggtcggtgaacagccccacatcgcccctggcgaagagtac
cagtacaccagcggcgcggtgattgaaacgccgatgggtaccatgcaaggccattatgaa
atggtcgatgtcgatggcaatggcttccgcgttgccattcccgtgttccgtctcgccgta
accacacttattcattaa

DBGET integrated database retrieval system