KEGG   Lelliottia nimipressuralis: CWR52_13170Help
Entry
CWR52_13170       CDS       T05333                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
lni  Lelliottia nimipressuralis
Pathway
lni00561  Glycerolipid metabolism
lni00640  Propanoate metabolism
lni01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CWR52_13170
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    CWR52_13170
Enzymes [BR:lni01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     CWR52_13170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: AVH18082
UniProt: A0A2L2JDZ8
Position
complement(2722215..2723318)
Genome map
AA seq 367 aa AA seqDB search
MDRIIQSPGKYIQGADVLTRLGDYLKPLANRWLVVGDKFVLGFAEETLRQSFKKAELHAE
IAPFGGECSQNEIDRLRKLADSADCLAVLGIGGGKTLDTAKALAHFMDVPVAIAPTIAST
DAPCSALSVIYTDSGEFDRYLMLPHNPNMVIVDTKVVAGAPARLLAAGIGDALATWFEAR
ACSRSGATTMAGGKCTQAALALAELCYNTLVEEGEKAMLAAEQHVVTPALERIIEANTYL
SGVGFESGGLAAAHAIHNGMTSVPDAHHFYHGEKVAFGTLTQLVLENAPVEEIETVAALC
HSVGLPITLAQLNIKEDIPAKMRLIAEASCAEGETIHNMPGGVTPDQVYAALLVADQYGQ
RFLQEWE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggaccgtatcattcaatcgccggggaaatatatccagggcgctgatgtgctcacccgt
ctcggcgactacctgaaacctctggccaatcgctggctggttgtcggcgataaatttgta
ctgggttttgccgaagagaccctgcgtcagagttttaaaaaagccgaactgcatgccgaa
atcgcgccgtttggtggcgaatgctcacaaaatgaaatcgatcggctgagaaaactggcc
gacagcgccgactgtttggcggtcctgggcattggcggcggtaaaacgctggataccgcc
aaagcgctggcccactttatggacgtgccggtcgccattgcgccgactatcgcttccacc
gatgcgccctgcagcgccctttccgtcatttacaccgacagcggtgagttcgatcgctac
ctgatgctgccgcacaacccgaacatggtcattgtggatacgaaagtggtagcgggtgcg
ccagcacgtctgctggccgccgggattggcgatgcgctggcgacgtggtttgaagcgcgc
gcctgctcgcgcagcggcgcgactaccatggccggaggtaaatgcacccaggcggcgtta
gccctggccgagctgtgctacaacacgctggttgaagagggtgaaaaagcgatgctggcg
gcggaacagcatgtggtaacgcctgcgctggaacgcatcatcgaagccaacacctatctc
agcggcgtcggttttgaaagcggtggcctggcagcggcacacgctattcataacggcatg
acgtcggtgccggatgcacatcacttctatcatggcgagaaagtggcgtttggtacgctg
acgcagctggtgctggaaaacgcgccggtagaagaaatagagaccgtcgcggcgctttgc
cacagcgttgggctgccaatcacgctggcacaactgaacatcaaagaggatattccggcc
aaaatgcgtctgatcgccgaagcgtcctgtgcggaaggagaaaccatccacaacatgccc
ggcggcgtcacgccggatcaggtctatgcggcgctactggtggccgaccagtatggacag
cgattcctgcaggagtgggagtaa

DBGET integrated database retrieval system