KEGG   Loa loa (eye worm): LOAG_01264Help
Entry
LOAG_01264        CDS       T02664                                 

Definition
(RefSeq) cmgc/cdk/pitslre protein kinase
  KO
K08818  cell division cycle 2-like [EC:2.7.11.22]
Organism
loa  Loa loa (eye worm)
Brite
KEGG Orthology (KO) [BR:loa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:loa01001]
    LOAG_01264
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:loa03041]
    LOAG_01264
Enzymes [BR:loa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     LOAG_01264
Protein kinases [BR:loa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   LOAG_01264
Spliceosome [BR:loa03041]
 Complex A
  Other components
   Complex A specific factors
    LOAG_01264
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like DUF1823
Motif
Other DBs
NCBI-GeneID: 9938635
NCBI-ProteinID: XP_020303878
AA seq 835 aa AA seqDB search
MNSPSDDGQYTDTDREEGAIDDDRKSSEGSTSIERPPVSCNSSDPNGHNIKVGKRCQENS
SASSSDVEGEEARLRQKLLERRSVLNSSSALKREVIEVERGSTSSVSVTITNIDKKSKSK
IRSISPKTKKSLKLTPNINGSSDDEEMFSIQPKEPAVKQRSHSARPHEYRERERGGLSDK
IRKPEKTRDEKHWHKERKHDKHTHGDYSNRDYDSRETHKRHISGKHQQSREHESRLAGRV
VLPDSKLTQKPSSVKMSYKERENHGELKAERLHHAKDASKGRSPRKREGNTSPKRAGVAL
EGEVSSKKMHMEKVDGTDVTVTNANDNAGKTEKTVPEVYAEIHSNKFDQATSTDEMDDEQ
PSVSQKATPMGPSKYSKFDSDPEDEQEEKDEAKHSGVNDKTEMVVDSASDAQSDVILRDL
DEDSMDLLDFDEERMASLSPETRTRLEEEQQKRLIARLPVYYPGISGCRNVAEFECLNRI
EEGTFGVVYRAKEKKTDEIVALKRLKMEKEKEGFPITSLREINMLLKAGNHPNIVNVREI
VIGSNMDKIYLVMEYVEHDMKSLMDTMHSRGKRFRTGEVKTLLHQLLSGVAHMHDEWILH
RDLKTSNLLLSHKGILKIGDFGLSREFGDPLKPYTPIVVTLWYRAPELLLGVKEYSTAVD
MWSCGCIFAEFLKLKPLFPGKGEMDQINKIFTDLGTPDDKLWPGYSSLPGPRKTTFEHHH
SGELEKKFPTSLVDERGLEFIKELLTYNPTKRISAHEALAHDWFERYPPPTPPEMFPTWP
AKSELGKSIVKTPITKSSSKEMQNAKLYKELKVEPKKEASTSFALKFDVAAKFSK
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgccatcagatgatggacaatatacagatactgatagagaggaaggtgcaatc
gatgatgataggaagagctcagaaggcagcacttctatcgaacggccacctgtttcttgc
aatagttcggatccgaatggtcataatataaaagtgggaaaaagatgtcaggaaaattca
tcagcttcatcgagtgatgttgaaggtgaagaagctcgattacgccaaaagctgctagaa
aggcgtagtgtgctgaacagttcttcagcattgaagcgtgaagttatcgaagtagagcgt
ggtagtacatcatcggtttccgtcacgattaccaatatcgataagaaatcgaagtcaaaa
atacgatcgatatctcctaaaacgaaaaagtcattgaaactaacgcccaatataaatggc
tccagtgatgatgaagagatgttttccatacagcctaaagaaccggctgtaaagcagcgc
agtcattccgcccgtcctcatgagtatagggaacgtgaacgcggaggactcagtgataag
atcagaaagccggaaaaaacgagagatgagaaacactggcacaaggaacgaaaacatgac
aagcacactcatggtgattattccaacagagattatgattctcgagagacccataaacgt
cacatctctggcaaacatcaacagtcgcgggaacatgaatcacggcttgctgggcgtgta
gttttacccgattcaaaattgacacagaaaccttcatctgtaaaaatgtcttacaaagaa
cgtgaaaatcacggtgaactcaaagcagaacgattacatcatgcaaaagatgcaagtaaa
ggtcggtctccacgtaaacgtgaaggtaacacaagtcccaaacgagctggtgttgcttta
gaaggagaagtatcatcaaaaaaaatgcatatggaaaaagttgatggaaccgatgtgaca
gtaacaaacgcgaatgacaatgcagggaaaacagaaaagacagtacctgaggtatatgct
gaaatacacagtaataagtttgatcaagcgactagtacagatgaaatggatgatgagcaa
ccatcggtttcacaaaaagctacgccaatgggtccatcaaagtactcaaagttcgatagt
gatccagaagatgagcaagaagaaaaggacgaagccaaacattctggtgtaaacgacaag
acagaaatggttgtggatagtgcttcggatgcgcaaagtgacgtaattttacgtgatttg
gatgaggatagcatggatttgctcgattttgatgaggaacggatggcaagtttgtcgcca
gaaacacgaaccagactcgaagaggagcagcaaaagaggctaatagctaggttgcctgtt
tattatcctggtattagtggatgccgaaacgttgcagaatttgaatgtttgaaccgcatt
gaagaaggcacttttggtgttgtttatcgtgctaaggagaaaaaaacagatgaaatagtt
gcactaaagcgtttaaagatggaaaaagaaaaggaaggcttcccaattacatcgcttcgt
gaaattaacatgcttctgaaagctggcaatcatccaaacattgttaatgttcgagaaata
gtgattggttcgaatatggacaaaatttacttggtcatggaatatgttgaacatgatatg
aaaagcctcatggacactatgcactcgcgtggaaagcgtttcaggacaggcgaagtgaaa
actttacttcatcaactgctttccggtgttgcacacatgcatgatgaatggattttgcat
cgagatttaaaaacatcaaaccttcttttgtcacataaaggaatcctaaagatcggcgat
tttggcttgtcacgagaatttggggatcctttgaaaccgtatacaccgattgttgttaca
ctgtggtatagagctccggaattattgctgggtgttaaggagtattcaacagctgtcgat
atgtggtcttgcggttgtatttttgctgaattcctaaaattaaaaccattgtttcctgga
aagggtgaaatggatcaaattaataaaatcttcactgatctcgggactccggatgataaa
ctctggcctggatatagcagccttcccggtccaagaaaaacgacttttgagcatcaccat
tcaggagaattagagaagaaatttccgacaagtttggtcgatgagagaggattagaattc
attaaagaattactgacctataacccaactaaacgaatttctgctcatgaagctttggct
catgattggtttgagcgttatccaccacccacaccgccggaaatgttcccaacatggcca
gcaaaaagtgaattgggtaaatcgatcgtaaagacaccgattacaaaatcttcatctaaa
gaaatgcaaaacgcgaagttgtacaaagagctaaaagtcgagccgaagaaagaagcatca
acaagttttgcgttaaagtttgatgtagctgcaaagttcagcaaatga

DBGET integrated database retrieval system