KEGG   Loa loa (eye worm): LOAG_01324Help
Entry
LOAG_01324        CDS       T02664                                 

Definition
(RefSeq) hypothetical protein
  KO
K14553  U3 small nucleolar RNA-associated protein 18
Organism
loa  Loa loa (eye worm)
Pathway
loa03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    LOAG_01324
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:loa03009]
    LOAG_01324
Ribosome biogenesis [BR:loa03009]
 Eukaryotic type
  90S particles
   U3 small nucleolar RNA-associated proteins
    LOAG_01324
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Formyl_trans_C
Motif
Other DBs
NCBI-GeneID: 9938697
NCBI-ProteinID: XP_003136911
UniProt: A0A1I7VPL2
AA seq 484 aa AA seqDB search
MVRQKRTAVQEEEDRLAKKLFGSNAGFPDGFEDSDDDVDDEVEGTFKAEEEAAKKPVWQD
EDDEVEEAVVDVPLHRKKVHIRKATDALNQKITPKEYEGRLRQLFHHSSGAAPAWSQSSF
CESKKIQNSGSDDDDLEDALHEVTAFTGKCITSSKSLTKGVISMKRLNNITRGHRFGKKP
MRALQFHPTRKVLMCAGENGLLSLFEIGLPETEEAFLQNVRFKALPITSASFTADGSKII
VGSKRKESLFCYDLLNGKVMQMRTPYEMAKVHMGYFSLSSDGKYIAVLEHNEVHILTSTS
SEYVGVLTASVKIASVQFFPNDSSTVFALGENGQVFIWNIRKPRGQQTFHDEGSVRGTVI
RISENGQYIACGSNTGIVNLYDSTDVQTNLFPKPVKVLDNLTTSIDCMAFNTDSQILSIS
SSVKNNSIRLMHVGSRTVYTNFPSRAVSLGKVTVADFSPKSAYMGVGDDRGFLSLFRLSH
FTTY
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggttcggcagaagaggaccgcggtccaagaggaagaagatcggttggcgaaaaaattg
ttcggtagcaatgctggcttcccagatggctttgaggatagcgatgatgatgttgatgac
gaggtggaaggaacatttaaagcagaggaagaagctgctaagaaacccgtttggcaggat
gaagatgatgaggttgaagaggcagttgttgatgtgccactgcatcgtaaaaaagtacac
attaggaaagcaacagatgctctgaatcagaaaataactccgaaggaatatgagggacga
ttacgacagttgtttcaccacagttctggtgctgctccagcgtggtctcaatcttccttt
tgtgaaagcaagaaaatacaaaattctggatcagatgacgacgatctggaggatgcattg
cacgaagtaactgcgtttacaggaaaatgtatcaccagcagcaaatcattaacgaaaggc
gtaattagcatgaaacgattgaataacattacacgtgggcatcgatttgggaagaaaccg
atgagagcattacaatttcatcctactcgtaaggtacttatgtgtgccggtgaaaatggt
cttctcagtcttttcgagataggcttaccagaaacagaggaagcttttctgcaaaatgtt
cgttttaaggcactcccaatcaccagtgcttcttttactgcagacggttccaaaataatt
gttggctcgaaaaggaaggaatctcttttttgctacgaccttctgaatggcaaagtgatg
caaatgagaactccgtatgaaatggcgaaagtgcacatggggtatttttcgctttcgtct
gatggcaaatacatagctgttctggagcacaacgaagtacatattttaacttcaacgtca
tcggaatatgttggcgtcctgacagcttcagtaaaaattgcatctgtgcaattctttccg
aatgattcatcgaccgtttttgctctcggtgaaaatggacaggtatttatatggaacatc
agaaagccaagaggacaacaaacatttcatgatgaaggttcagttagaggaacagtgata
cgaataagtgaaaatggtcaatacatcgcctgtggatctaatacaggaattgtaaatcta
tacgactctacggatgtccagacaaatttgttccccaaacccgtaaaagtactcgataat
cttacaacaagtattgattgtatggcatttaatactgattcgcaaattctttcaatatct
tcgagtgtaaaaaataattcgatccggttgatgcatgttgggagccgaactgtttataca
aatttcccgtcaagagctgtaagtcttggaaaagtaacggtggctgacttttcaccaaaa
agtgcttatatgggtgttggtgatgatcggggcttcctttccctatttagactttcacat
ttcactacttattaa

DBGET integrated database retrieval system