KEGG   Loa loa (eye worm): LOAG_03841Help
Entry
LOAG_03841        CDS       T02664                                 

Definition
(RefSeq) hypothetical protein
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
loa  Loa loa (eye worm)
Pathway
loa00061  Fatty acid biosynthesis
loa00071  Fatty acid degradation
loa01100  Metabolic pathways
loa01212  Fatty acid metabolism
loa04146  Peroxisome
Module
loa_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:loa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LOAG_03841
   00071 Fatty acid degradation
    LOAG_03841
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    LOAG_03841
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:loa01004]
    LOAG_03841
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:loa04147]
    LOAG_03841
Enzymes [BR:loa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     LOAG_03841
Lipid biosynthesis proteins [BR:loa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   LOAG_03841
Exosome [BR:loa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   LOAG_03841
  Exosomal proteins of breast cancer cells
   LOAG_03841
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-GeneID: 9941232
NCBI-ProteinID: XP_003139426
UniProt: A0A1I7VU38
AA seq 139 aa AA seqDB search
MKGRSNLWCNVDGPIREDFPGEDTVDKLFTHAAKLYDDKIVLGTREVLKVIIFAETRADW
LITSLFHINIPVAIVYATLGEKAIIQAISETEATLLVTSAELLTKIVTIRKKISNLQLLV
YFRSLQSSKKIVNMDIIKE
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgaagggtagaagtaatttgtggtgtaatgtagatgggccaataagagaggatttcccg
ggggaagatacagttgacaaattattcacccatgcggcaaagttatatgatgataaaata
gtcctgggtacacgtgaagtgctaaaggttattatttttgcggaaactcgagctgattgg
cttatcacttcactcttccatattaatataccagttgctatagtttacgcaacacttgga
gagaaagcaataattcaagcaatcagtgaaacagaagctacattattggtgacatctgct
gaattgttaacaaaaattgtgacaataaggaagaaaatatcaaatttacaattgttagtg
tattttcgctccttacaatcttcaaagaaaattgtcaatatggatatcatcaaggaataa

DBGET integrated database retrieval system