KEGG   Loa loa (eye worm): LOAG_04806Help
Entry
LOAG_04806        CDS       T02664                                 

Definition
(RefSeq) hypothetical protein
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
loa  Loa loa (eye worm)
Brite
KEGG Orthology (KO) [BR:loa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:loa04131]
    LOAG_04806
Membrane trafficking [BR:loa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    LOAG_04806
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398
Motif
Other DBs
NCBI-GeneID: 9942210
NCBI-ProteinID: XP_003140391
UniProt: A0A1S0U1V5
AA seq 2160 aa AA seqDB search
MSSQGGQRAFASKRNKMTAADVRRHIMMGSLLLHPQNAMQMDATDSSPQTINLIEIAESL
DVEDILSQRKSNSSVNEHIATNSNLRRMAEFPADDIEVRLVYRDQLTVESPIPSNLSGVD
PLVKDIIQTYNDSFSLVQRKYVQYSSGEAYIRLLMERPIIAQTTPKQIFEVDSDRPIGRS
VSTVGEDQIAKRDSFGSHYSSDSMCTVGSSSGGTNRDDTLRAPHQLHSSASDPTVPGVMQ
RISNTQLDQINEARRRAHRQNALINLLPPQPETDVIERRSAAPFPVEHTGQKLFIKVLKL
QLEPSFEPVFGTIVLYDLKGKRKISENFYFDVNDDLLQAMISQHADCVDEASKCTQAVFS
ISQPLNDIFIVIKLEKVLQPCEVADACEPYLKEDKNKERLMQTAQHYCERLGAFRMPLGW
FAIDLNQILNGSHRPDKTEALTAMIASSVAGQDVTPASPTTLFDVESIISMDRISNSTSG
TFRRVGSGTSSGAVFVGAQQPQKSRTPLQKRKIFGGLHLTISQSDTTAVGSGLETDSLLR
DGGSPLTSLNALQPLLLSLNSFFRQEAERLTDEDLCKMLADCRKGGSKLARLKTFPITFK
MELSGGCGESLMRNLLYVYPRSVNLSSRSGPSRNIAIHVELMNAQEKPVYAIFGKSSGPN
ITFSADTAVSYHNKTPSFYDEIKVNLPVDLNDGHHILFTFFHITCKPNKVGDEVKIPIGY
SWIPLLKDGRLQTGEFTLPIALEQLPQSYGYLSPDVNLPNVRWLEGHKPLFDVKLEAVTT
VHTQDSHLDRFLAAYQSLIVNDKKNPPVSEVDLKDAIRSVIKARPEPMVAFLYVILDKLL
ALIANPPYTVSVSAVCFEVLGQLVKICTVLLNSFRDAHGRSSLLTTYIHYHKIALRETPI
VQLKSSKTEAKSEGTLPTSPESKHLLDIIKEFERTNYMKASVEGDREPKESKKVMHEELA
LQWVISGGAAREMAFLNSWFFLELMIKSMAEHLSLSNRLYLPRKLRFSEAFIQDLNALSQ
AVVSEVVQRTSKDPRQSQSISISWAYFLRDCFSLMDRTFVMTLVREFNREIAAKIGNSAE
SCMVPTLMLIKLDFLRIIASHEHFVVLNLPFGSGNIQGMSTSHSGGSFHSAASAFSSSSE
GSANLTASLRHSSHIQLPSPGNSNITDSQAYESHGPVGSAELTVEFRSRHFLIGLALADL
ASVLETSNTLLQSRAISLIRNLLSTHELDARLLDNTVKARVASLYLPMIGIVLDASAQLH
DPYSKSSSANYEISTSVSSGYATEIDNSPFINDKVMLAIGGVNFSPPCSPRTERRHIGLM
RPSLSLENTRQLLACFCWALKNMERSYLRQWIRDLSSNRILQFLNVLQLAVSCFEFRSSL
FCSDQGTTEITEEVKDEGSNIEGLSVKEVSRKKLRCAADPESGVRWRKETKDSQGKDSWK
SCTGSSGGQSTDEPIPSDEDLTLEATLCTEIPLIVLDTLELIIRVVSVLGSDYLFYVLPS
VLKVLMHILACNQSVQTLENVFASQRAIVTKYPDLLFEQETEQCGELCLHLLRHCASRLP
AVRSQAAASLYLLMRQSFESGASFSKVKMQITMSLSTLVSTGTKHGDWINEDCLRHSLKT
VLTYSETDASVDSQLRNTTFSEQVKDLVFNLHMILSDTVKMKEYTNDFEMLIDLMYRVAK
GYQNNPDLRLTWLINMANKHSARDNAAEAAQCMLHAAALAAEYISMREYDVYVPKGAAAF
EAISDNILEESAVSDDVISPDEEGICESRHFTQNGLVHLVEKTAQFMEKAQMYESMVQLY
KVITPILEENRDYRHLAQVHSCLSQALSRIEPTIPLVEDIADAWFSPLPSADKRCFGTYF
RVGFYGSRFGDLDGVEFIYKEPAITKLSEISHRLDAFYTDRFGKGVVEVIKDSNIVDRNR
LDSTKAYLQITYVEPYLESWERRRRPTHFERNHKLYRFVYATPFTKDGRAHGDLKDQYKR
RTVLATQYCFPYVKTRLQVVSREQIILTPIEVAIEDVQKRTRELAAATAQDPPDAKMLQM
VLQGCIGTTVNQGPIEVANVFLTNMVLDERGKPMDKFQNKLRLCFKDFSKKCADALQKNR
KLIQADQQAYQNELQKNYIEFTKRMAPIVGIRKSKCSEAHTLKAVHAAAVAAEIGPVTAV
NT seq 6483 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcacaaggtggacagcgggcatttgcttcgaaacgaaataagatgactgcagct
gatgtacgtcgacatattatgatgggaagtttgttactgcatccgcaaaatgccatgcaa
atggatgcaacggacagtagtcctcaaactatcaatttaattgagatagctgaatcgctg
gatgtggaagacatcttatcgcaacgaaaaagcaactcttccgtgaatgaacatattgcc
actaacagtaatttgagaaggatggcagagtttccggctgatgatatcgaagtacgtttg
gtataccgagatcagcttacggtcgaatcaccgattccatcaaatctttcaggtgtcgat
ccactggtaaaagatattatacaaacatacaatgatagtttttcgctagtacagcgaaag
tatgtgcaatattcaagcggtgaagcatatattcgattactaatggaacggccgattatt
gctcaaactacaccaaaacaaatttttgaagttgattcggaccgacctatcgggcgaagt
gttagcacagtaggcgaggatcagatcgcaaaacgtgactcattcggttcacactattcg
tccgattcaatgtgtactgttggttcgtcatccggtggaacgaatcgtgatgataccttg
cgtgcacctcatcaacttcattcttctgctagtgatcccacagtgccaggtgtgatgcag
cgtatttcaaatacacaacttgatcaaattaatgaagcccgaagacgagcccatcgacaa
aatgcattgattaacttacttccgcctcaacccgaaactgatgtaattgaacgtcgaagc
gcagcgccattcccggttgagcatacgggtcagaaacttttcatcaaagttttgaagtta
cagcttgaaccttcgttcgaacctgttttcggtaccatagtgctttatgatttgaaggga
aagcgaaaaatatcggaaaatttctattttgatgtaaatgatgatttgctccaagcaatg
atttcgcaacacgctgattgtgtggatgaggcaagcaaatgtacacaagcggttttcagt
ataagtcaaccactgaatgatatatttattgtcatcaagctggaaaaagtgttacaacca
tgcgaagtagcagatgcatgtgagccgtatctgaaagaagataaaaacaaggaacggttg
atgcaaacggcacagcactattgtgaacgacttggtgcttttcgaatgccacttggttgg
tttgccattgacctgaatcaaatccttaatggatcacaccgtccggataaaacggaagca
ttaacggcaatgattgcgagctctgttgctggacaggatgtaacaccagcttcaccaact
acattgttcgatgtagaaagtattatcagtatggatcgaatatcgaattcaacatccgga
acatttcgtcgcgtgggtagcggaacttcatccggtgctgtttttgtgggtgcacagcaa
ccccaaaaaagtcgtacaccattgcaaaaacgtaaaatttttggaggccttcatttgact
atctcgcaaagtgatacaactgcagtgggatcaggtctcgaaactgactcactactgaga
gatggcggttccccgttgacttctttaaatgctttacaacctttgctgctcagtttaaat
tcgttctttagacaggaagcagaacgtttgactgatgaggatctgtgcaaaatgcttgcg
gattgtcgaaaaggtggttccaagttagctaggctgaagacatttccaatcacattcaaa
atggaattgtcaggtggatgtggcgagtctttaatgaggaacttgctttacgtttatcct
cgatcagtaaatttatccagtcgctctggcccatcacgtaacattgccatacatgtggaa
ctgatgaatgcccaggaaaaacctgtttatgctatatttggtaaatcgagtgggccaaac
attactttttctgctgatactgcagtttcctatcataacaaaacaccaagtttctacgat
gaaataaaagtcaatttgccggttgatttaaatgatggccatcacatactattcactttt
ttccacattacttgtaagccaaataaagttggcgatgaagtaaaaatacccatagggtat
tcatggattccactgctgaaagatggacgattgcaaactggtgaatttactttgccgatt
gcattagaacagttaccgcaaagttacgggtatctttcaccggatgttaatttaccgaat
gttagatggctggaaggacacaaaccgctttttgatgttaaacttgaggctgttacaaca
gttcatacacaggactctcatttggacagatttctggctgcgtatcaatcgttaattgta
aacgataaaaagaatccaccggtatcggaagtcgatttaaaggatgcaataagaagtgtc
ataaaagctcgcccggaaccaatggttgctttcctttatgttatactggataagttgttg
gctctaattgcaaatcctccatataccgtatctgtgtcagctgtatgctttgaagtgctt
ggacaacttgtcaaaatatgtaccgttctcttgaatagcttccgcgatgcccatggtcgt
agttcactcctcaccacatatatacattaccacaaaattgcccttagagaaactccaatc
gtacaactaaagagcagtaagacggaggcgaaatcggaaggtactctacctacttcacca
gaaagcaagcatttgctcgatattattaaagaatttgaacgaacaaattacatgaaggca
tctgttgaaggtgaccgtgaaccgaaagaatcgaaaaaggtgatgcacgaagaattagca
ttgcagtgggtaatcagtggtggtgcagctcgagaaatggcttttcttaattcctggttc
ttccttgaacttatgattaaatcaatggcagaacatttatctctttcaaatcgtttgtat
ttgccgcgcaagcttcgctttagtgaagcttttatccaagatttgaatgccctttctcag
gctgttgtcagcgaggtggtccaaagaacttcgaaagatccaagacagtcgcaatcaatc
agtatttcttgggcatatttcttgcgtgattgtttttcattgatggatcgaacttttgtg
atgacattggtcagagagtttaaccgcgaaatcgctgctaaaataggaaactccgccgaa
tcatgcatggtcccgaccctcatgctaattaagttggactttttgcgtattattgcttct
catgagcatttcgttgtgttgaacttgccatttggttctggtaacatacagggtatgtca
acaagccattccggtggatcatttcattcagcagcatcggcattttcatctagttcggaa
ggtagcgccaatttaactgcatcgttgcgtcattcttcacatatccaacttcctagtcca
ggaaattcaaatatcactgacagtcaagcatatgaatcacatggtccagttggatcagca
gagttaactgttgagtttcgttcgcggcattttctaattgggcttgccctagctgacctg
gcttctgttcttgagacttcaaacactctgcttcaatcacgtgctataagccttattcgt
aatttgctgagcacccatgaattggatgctcgtcttcttgataacacggtgaaagcgcga
gtggcatccttatatttaccaatgatcggcattgttctggatgcatcagctcaattgcat
gacccttactcgaaatcttctagtgctaactatgagatttccacatccgtttctagtggt
tacgcaacagaaatagacaacagtccatttatcaacgataaagttatgcttgcaattggt
ggggtgaatttttcgccaccttgctcaccacggaccgaacgaagacatattggtttaatg
cgaccatcactttcattggaaaatacacgtcagctgttagcatgtttttgttgggcgctg
aaaaatatggagcggtcatatttgcgtcaatggattcgcgatttatcatccaaccgaatt
ttacagtttctcaatgttttacagcttgctgtttcatgcttcgaattcagatcatctctt
ttctgttctgatcaaggtaccactgagattacagaagaagtaaaggatgaaggtagtaat
atcgaaggtttgtcggtcaaagaggttagccggaaaaaattacgctgtgcagccgatcct
gaaagtggtgttcgatggcgtaaagaaaccaaagattcacaagggaaagattcttggaaa
agttgcactggtagtagtggtggacagtcaactgatgaacctatcccaagtgatgaagat
cttacgcttgaagcgacactttgcaccgagataccattaatagtgctggatacgttagaa
ttaattatacgtgtggtttcggttcttggttctgattatctcttttatgtgttaccttcc
gtattaaaagtattgatgcacattcttgcatgcaaccagtctgtgcaaactttggaaaat
gtatttgcaagtcagcgtgcaatagttacgaagtatccagatttattgtttgaacaggag
actgaacaatgcggtgaattatgccttcatctactaagacattgtgcatcccggttgcca
gctgttcgttcgcaggctgcagcatcgttatacctgttgatgaggcagagtttcgaatca
ggagcaagtttttcaaaagttaagatgcaaattacgatgtcattgagtactttggtttcc
acgggcaccaaacatggtgactggataaatgaagattgtttacgtcacagtttaaaaact
gtgctaacatattcagaaacggacgcttccgttgattcgcagctgcgcaacactactttt
tcagagcaggtaaaagatcttgttttcaatttgcatatgatattgtcggacacagtgaaa
atgaaggaatacacaaatgattttgaaatgctaatcgatctcatgtatcgtgtcgcgaaa
ggatatcagaacaatccagatcttaggttgacgtggttgataaatatggcaaataagcat
tcagcccgggataatgcagcggaagccgcacaatgtatgttacatgcagccgctttagct
gctgaatatatttcgatgcgtgagtatgatgtgtatgtgcctaaaggtgctgctgctttc
gaagccataagtgataatattctcgaagaaagtgctgtttcagatgatgttattagtcct
gatgaagaaggtatttgtgaaagtcgtcattttacacaaaatggtttagtacatttggta
gagaaaacggcgcagtttatggagaaagctcaaatgtatgaatcaatggtacaactctac
aaggtaataacaccaattttggaagaaaatcgtgattatcggcatttggcacaagtacat
agttgtctgagtcaagcgctttctcgtatcgaaccaactataccgctggttgaagacatt
gctgatgcgtggttttcacctttaccaagtgccgacaaacgttgtttcggtacctatttt
cgggtaggtttttatggcagtcgttttggtgatttggacggtgtcgaattcatctataaa
gagccggcaattacgaaattgtccgaaattagccatcgtttggatgcattttacacagat
cgttttggaaaaggagttgtggaagttattaaagattcaaatattgttgatcgaaatcgt
ttggattctaccaaagcctatttgcaaatcacatatgtagaaccgtatttggagagttgg
gaacggcgtcgtcgtcccactcatttcgagagaaatcacaagttatatcgatttgtctat
gcgacaccgtttacgaaagatggtcgggcccatggtgatttgaaggatcagtacaaaaga
cgaactgtgctagccacgcaatattgttttccatacgtaaaaacacgccttcaagtggtg
agtcgcgaacaaataattttgacgccaattgaagttgcaattgaagatgtccaaaaacga
actcgtgaattagctgctgctactgcgcaagatccaccagatgctaaaatgcttcaaatg
gtactgcaaggttgcattggtaccactgtcaaccaaggtcctatagaagttgccaacgta
ttccttacaaatatggttttggatgaacgtggcaaaccgatggataaattccagaataag
cttcgcttatgtttcaaagatttctcgaagaaatgtgctgatgctcttcagaagaacaga
aaacttattcaggctgatcagcaggcttatcagaatgaactgcagaaaaattatatcgaa
tttacaaaacgaatggcaccgattgttggcatccgtaaaagtaagtgttctgaagcacat
actctaaaagctgtacatgcagctgctgttgctgctgaaattgggccggttactgcagtg
tga

DBGET integrated database retrieval system