KEGG   Loa loa (eye worm): LOAG_10334Help
Entry
LOAG_10334        CDS       T02664                                 

Definition
(RefSeq) hypothetical protein
  KO
K17890  autophagy-related protein 16-1
Organism
loa  Loa loa (eye worm)
Pathway
loa04136  Autophagy - other
loa04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:loa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    LOAG_10334
   04136 Autophagy - other
    LOAG_10334
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:loa04131]
    LOAG_10334
   03029 Mitochondrial biogenesis [BR:loa03029]
    LOAG_10334
Membrane trafficking [BR:loa04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    LOAG_10334
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    LOAG_10334
Mitochondrial biogenesis [BR:loa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    LOAG_10334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 Occludin_ELL
Motif
Other DBs
NCBI-GeneID: 9947778
NCBI-ProteinID: XP_020301688
AA seq 534 aa AA seqDB search
MDETDTTDNSFRATIIHQLERRNIICRQFDSLFTSYCELTEYVANVARNGRIRHGSSASL
AGSSDRTLELEAELADLYRKKEQNDQQLIETNNRLEVVVRELSAVSIVKEECQKENQKLK
KKLKEKEEELTALKEANIFLKDEHFALQASYNSIENKYREAQEERNNLVDRIKDLKEKEV
QWFNEQNEREQEEHRRRLAADIESALTMSHNNEDKTYGFEIINNTNQVVDYKGDIIPGHC
KTKLDYGDDINDILWHPSGNMFAGGGGDHKLRLYKVVNDKFEKIVSLAGSNESVLRIDFA
AETNQVLGAGNDNAVRIWGTDNHVVKHSLTGHGNKVSSAKFFHDGLQVVSGSYDRTFKLW
DLKTAKCLRTYFTNSVVYDITSSDKNGMVASGHYDRKVRFWDIRLNEPVRVVELANKVTS
LVLSFDSSVVLASARDETMSLIDLRSYQIVHIYSADQYRTGSDHIRCAISPGMEYIASGS
SDGSIFIWNLKTTKLEKTLQKGGHERGVHSVSWHPKGNMLLSAGKEKTVCLWTV
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaacggatacgacagataacagcttccgtgcaacgatcatacatcaacttgaa
cgtcgaaatattatatgcagacagttcgattccttgttcacttcttattgtgaactaaca
gagtatgtagcgaatgttgcacgtaacggtcgtatacgtcacggctcgagtgcttcatta
gcaggaagctcggatcgcacgttggaactggaagctgagcttgcagatctttaccgtaaa
aaggagcaaaatgatcaacagttgattgaaacaaacaatcgtttggaagttgttgttcga
gaactaagcgcagttagtattgtaaaagaagagtgtcaaaaggagaatcaaaagttgaag
aaaaaattgaaagaaaaagaagaggaattaactgcattaaaagaagcaaacattttttta
aaggatgaacattttgctttgcaggcaagttataatagcatcgaaaacaaatatcgagaa
gcacaggaggaacgaaataatctggttgatcgaataaaggatcttaaagagaaagaagtc
cagtggtttaatgaacaaaatgaacgagagcaagaggaacatcgtcgccgtttagcagcc
gatattgagtctgcactaaccatgtcacacaacaacgaggacaaaacgtatggatttgaa
attatcaacaatacaaatcaagtcgttgattataaaggcgacattattcctggtcactgt
aaaacaaaactggattatggcgatgatattaacgatattctttggcatcccagtggtaac
atgtttgcgggaggcggtggcgatcataaacttcgtttatacaaagtagtaaatgacaaa
tttgaaaaaattgtttctttggctggttcaaatgaatcagtactacggatagatttcgca
gccgaaaccaatcaagttctcggagctggcaatgataatgccgttcgtatttggggaaca
gataaccatgtagtcaagcactcgttaacaggacatggaaataaggtatcatctgctaaa
ttttttcacgatggtttacaagttgtatctggatcttatgacagaacatttaaactatgg
gacttaaaaactgccaagtgtttgagaacatattttactaattcagtggtatatgacata
acttcgagtgacaagaatggaatggtagctagtggtcattacgatcgtaaagtacggttc
tgggatataagactcaatgaaccggttcgtgtagtcgaactcgccaacaaagttacatca
ctggttctgtcgtttgactcttccgttgtacttgcatcagcacgagacgaaacaatgtca
ttgatcgacctacgttcgtaccaaattgttcatatatacagtgctgatcagtatcggaca
ggaagtgatcacattcgttgtgcgataagtcctggaatggaatacatcgcatctgggtct
agtgatgggtccatttttatttggaatctgaaaacaaccaagcttgaaaaaacacttcaa
aagggtggacatgagcgaggcgtgcattcagtttcgtggcatcccaaaggaaatatgtta
cttagtgcaggaaaggaaaaaactgtttgcttatggactgtttga

DBGET integrated database retrieval system