KEGG   Loa loa (eye worm): LOAG_11300Help
Entry
LOAG_11300        CDS       T02664                                 

Definition
(RefSeq) hypothetical protein
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
loa  Loa loa (eye worm)
Brite
KEGG Orthology (KO) [BR:loa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:loa01002]
    LOAG_11300
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:loa04147]
    LOAG_11300
Enzymes [BR:loa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     LOAG_11300
Peptidases [BR:loa01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   LOAG_11300
Exosome [BR:loa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   LOAG_11300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Thioesterase DLH Peptidase_S9 Abhydrolase_2 LIP Lipase_3 Peptidase_S15 DUF900 DUF2974 BAAT_C COesterase FSH1 LIDHydrolase Say1_Mug180 Abhydrolase_5
Motif
Other DBs
NCBI-GeneID: 9948752
NCBI-ProteinID: XP_020301517
AA seq 301 aa AA seqDB search
MLFLNFVRIPFQDFANLTHHGVNSLGRNFYLRGENGLRLGCWHILPSEIAVNYRDPVLNA
REMERLMATSDNPVIIYLHGNSFDRSQSSRCGLYNLLANMGFHVLALDYRGYGDSNGSPS
EHGLIEDAKEIFRYARSHSSSNNIYLWGHSMGTAIATAAAMQFSEKGSPPAGLILESPFN
NLNDAVTHHPYTIPFRWLPWFKKMVLESLDRSGLDMSTDYRITKVNCPVLILHAEDDHII
PLQLARKLRDSALAAKRDVTLKEFDASRNFYHKFIYLADELPEILRRFTEKCTLKTKEAQ
Q
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcttttcctgaattttgtgaggataccattccaagattttgcaaatttaacacatcat
ggtgttaattcattgggaaggaatttttatttgcggggagaaaatggcttacgattggga
tgttggcacatattaccttctgagatagccgtgaattatcgagacccagtattaaatgcc
agagaaatggaacggctgatggcaacgtcagataatccggtaattatctatttacacggc
aattcatttgaccgatcacagtcaagtcgctgtggattgtataatttactggctaatatg
ggttttcatgtgctagctttagattatcgcggatatggcgattcaaatggttcaccaagt
gaacatggtttaattgaggatgcgaaggagatatttcgctatgcaagaagtcattccagt
tcaaataacatatatttatggggtcattcgatgggaacagcaattgctacagcagctgca
atgcaattcagtgaaaaaggatcaccaccagctggcttgatcctagaatcaccattcaat
aaccttaatgatgccgttactcatcatccatatacaataccattccgctggttgccttgg
tttaaaaaaatggtattagaatcattagacagatccggtctggacatgagcactgattat
cgcatcacaaaggtgaactgtccagtgttaatattacatgccgaagatgaccacatcatc
ccactgcaattggctcgtaaattgcgtgatagtgctttggctgccaagcgtgatgtgacc
ctgaaggaattcgatgcaagccgcaatttttaccacaaattcatttatttagctgatgag
ctacctgaaattctcaggcgatttacagaaaaatgtactttaaaaacgaaggaagcgcaa
cagtag

DBGET integrated database retrieval system