KEGG   Loa loa (eye worm): LOAG_11834Help
Entry
LOAG_11834        CDS       T02664                                 

Definition
(RefSeq) Erv1/Alr family protein
  KO
K10758  thiol oxidase [EC:1.8.3.2]
Organism
loa  Loa loa (eye worm)
Brite
KEGG Orthology (KO) [BR:loa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LOAG_11834
Enzymes [BR:loa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.3  With oxygen as acceptor
    1.8.3.2  thiol oxidase
     LOAG_11834
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Evr1_Alr Thioredoxin QSOX_Trx1 Thioredoxin_8 IR1-M
Motif
Other DBs
NCBI-GeneID: 9949293
NCBI-ProteinID: XP_003147399
UniProt: A0A1I7W0N4
AA seq 583 aa AA seqDB search
MFSLIILLIVFVSEKANGYVSNMNYVPMGTNPTLYRPGYDPVMQLDAVTFHDTIFMQDHA
FVVEFYADWCGHCRAFAPFYLEFASSVRSWENVVTVAAINCADIVNQKICSDEGIIGYPM
ILYYPRHARSRADAIKLEPRHSLPHMKSQLTQVIRNEYNQFRYADWPDFTYLTTDSAMEL
RNFWNQMNDSHQFLVLLFEQFDNVGVEFLLDMFPLQKTVLTRRIVVSSPVTRSFTITHLP
YVLVFKRNQDSPIYQNPYGQQSLQEVMRITYAIQKQPVLPVSPVPTPVMRQDIVQCELYH
DKCRELYYVSEVDMLKAMRMAIFDEVIKTDNNIADTNFTALLDFIITLAKHFPIYTSNTT
SQTTNQKSFAALRQSTRAKSVFLHLRHFLEAHRGKRTISTAVWRNQFQNIERVYGYPFPT
NASWEHCKGTALGYRGYTCGLWTTFHAITVNAFVQGLQSPISVLFSIRGWVANFFGCLDC
RRHFLHMTTTLYPLTKRRVQNTYDMMFYLWRAHNIVNARLHGDKATEDPQFEKRQFPPTF
LCSVCHSDGMFSRKNVRDFLVNFYTAIRPYNGTNHVSNSRKLS
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgttttcgttgataatactactgatagtattcgtatctgagaaagcgaatggttatgtc
tcgaatatgaattatgtaccgatgggtactaatccgaccctgtatcggccaggttatgat
ccagtcatgcagcttgatgctgtcacctttcacgatactatattcatgcaagatcatgcc
tttgtggttgaattctacgctgactggtgtggacactgtcgcgcctttgctccattttac
ttggagttcgcatcctccgtacgctcatgggaaaatgttgtaacagtggctgcaattaac
tgcgctgatattgtcaaccagaagatatgtagcgatgagggaatcatcggatatcctatg
atcctgtattaccctcgacatgcccgaagccgtgccgatgcaattaagctagagccaaga
cattctttaccgcatatgaaaagtcaacttacacaagttatacgaaacgaatataatcag
tttcgctatgcagactggccagacttcacctacttgacaactgacagtgcaatggaattg
agaaatttttggaatcaaatgaatgattcacatcaatttctggtcttgctattcgagcaa
ttcgataatgttggtgtggaattcttgctggatatgtttccgctccaaaaaacggtactt
accaggagaattgttgtttcttcacctgttactcggtcattcactatcacacatttgcca
tatgttttggttttcaaacgtaatcaagacagtcctatctatcaaaatccatatggtcag
cagtcgttgcaagaagtaatgaggataacatatgcgatacaaaagcagcctgtccttcct
gtctcaccggtaccaacacctgtcatgcggcaggatatcgtgcagtgcgagttatatcac
gataaatgtcgtgagttatactatgtgtcggaggtggatatgctgaaagcaatgcgcatg
gcaatattcgatgaagtaattaaaacagacaacaacattgctgatacgaactttacagca
cttctggacttcatcatcactcttgctaaacattttccaatttacacatctaatacaaca
tcacaaacaacgaatcagaaatcattcgcggccttgaggcaaagcacacgagccaaatca
gtctttttgcatcttcgacattttctagaagcacacaggggaaagcgtacaatttcgacg
gctgtatggcgaaatcaattccagaatattgaacgagtgtatggctatccgttcccgacg
aatgcttcctgggagcactgtaaaggtacagcattaggatatcgaggctatacttgtggt
ctatggacaacatttcacgcaatcactgttaatgctttcgtgcaaggactacaatcaccg
atcagtgtgctgttcagtatacgtggttgggtagccaacttctttggttgtctggattgt
cgacgacattttttgcacatgacaaccactctctatcccttaactaaacgtcgggtgcaa
aatacttacgatatgatgttctacctttggcgtgctcataacattgttaatgcccgactg
cacggagataaagcaacggaagatccacaatttgaaaagcgacagtttccaccaactttt
ctctgctcagtatgccattcagacggaatgttcagcagaaaaaatgtccgagacttctta
gtcaacttctacacagcaatcaggccatacaatggaacaaatcatgtttcgaatagtcga
aagctttcttag

DBGET integrated database retrieval system