KEGG   Legionella oakridgensis: Loa_01062Help
Entry
Loa_01062         CDS       T03928                                 

Definition
(GenBank) pterin-4a-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
lok  Legionella oakridgensis
Pathway
lok00790  Folate biosynthesis
lok01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lok00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Loa_01062
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lok04147]
    Loa_01062
Enzymes [BR:lok01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     Loa_01062
Exosome [BR:lok04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Loa_01062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a MIF4G
Motif
Other DBs
NCBI-ProteinID: AHE66618
UniProt: W0B7V2
Position
complement(968865..969206)
Genome map
AA seq 113 aa AA seqDB search
MSSDLTSKHCEACEGIGAALTPEQIQQLMPQLADAWQVSDDYKEISRSFAFKNFYETMAF
VNALAWIANLENHHPDLKVGYNYCHVHFTTHALKGLSLNDFICAAKTDKLLES
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtgatttaacaagtaaacattgtgaagcctgtgaaggcattggtgcagcactt
acgcctgaacaaattcagcagttgatgccacaacttgccgatgcatggcaagtttctgac
gattataaggaaattagccgttccttcgcatttaagaatttttatgaaaccatggctttt
gtcaatgctctggcatggatagctaatcttgaaaaccatcatccggatcttaaggtggga
tataattattgccatgttcatttcacaacgcatgccttaaaaggtctgtctctaaacgat
ttcatttgcgccgcaaaaactgacaagttactggaatcttaa

DBGET integrated database retrieval system