KEGG   Legionella oakridgensis: Loa_01509Help
Entry
Loa_01509         CDS       T03928                                 

Gene name
fadA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lok  Legionella oakridgensis
Pathway
lok00071  Fatty acid degradation
lok00072  Synthesis and degradation of ketone bodies
lok00280  Valine, leucine and isoleucine degradation
lok00310  Lysine degradation
lok00362  Benzoate degradation
lok00380  Tryptophan metabolism
lok00620  Pyruvate metabolism
lok00630  Glyoxylate and dicarboxylate metabolism
lok00640  Propanoate metabolism
lok00650  Butanoate metabolism
lok00900  Terpenoid backbone biosynthesis
lok01100  Metabolic pathways
lok01110  Biosynthesis of secondary metabolites
lok01120  Microbial metabolism in diverse environments
lok01130  Biosynthesis of antibiotics
lok01200  Carbon metabolism
lok01212  Fatty acid metabolism
lok02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Loa_01509 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    Loa_01509 (fadA)
   00640 Propanoate metabolism
    Loa_01509 (fadA)
   00650 Butanoate metabolism
    Loa_01509 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Loa_01509 (fadA)
   00072 Synthesis and degradation of ketone bodies
    Loa_01509 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Loa_01509 (fadA)
   00310 Lysine degradation
    Loa_01509 (fadA)
   00380 Tryptophan metabolism
    Loa_01509 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Loa_01509 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Loa_01509 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Loa_01509 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lok04147]
    Loa_01509 (fadA)
Enzymes [BR:lok01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Loa_01509 (fadA)
Exosome [BR:lok04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Loa_01509 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AHE67058
UniProt: W0B933
Position
1381274..1382593
Genome map
AA seq 439 aa AA seqDB search
MKHKSNLNGKDVYVVDGSRTPFLKAKEVGPFSGSDLAVAAGLPLLNRQPFSPKELDEVII
GSAMPGPDEANIARVTALRLGCGEKVPAFTVMRNCASGMQALDNAAMQIASGRSHLILAG
GTDAMSHAPLLFNQKMAAWLAKWYAAKTFRQRAGLIAEFRPSYLAPVVALLRGLTDPIVG
LNMGQTAEKLAFKFNITREQMDEYACESHRRLAEAFQEGRMQEVVPMIDAKGTLYLKDDG
IREDSTVEKLAKLKPFFDKKYGMVTAGNSSQITDGACLLLLASAEAVKKYKLPVMGKIVD
SQWAALDPAQMGLGPVHAATPIMERQHLKPQDFDCWEINEAFAAQVLACLAAWDDDEYCR
TQLGLKQAMGAPSRAVLNKDGGAIAAGHPIGASGARIVLHVLQDLQQRNGTRGMAAICIG
GGQGGAMFLERTTEVKGHE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaaacataaatcaaatttaaacggcaaagatgtttatgtggttgatggaagccgtacg
ccctttttaaaagctaaagaggtaggacctttcagtggttcggatttggcggtagccgct
ggtctgcctttgttaaatcgacagcctttttctcctaaagaattggatgaagtcattatt
ggttcagcaatgcccgggccggatgaagcaaacatagcccgggtgacggccttaagactg
ggatgtggggagaaggtcccagcatttactgtgatgcgaaattgtgcatctggtatgcag
gctttagataatgctgccatgcaaattgctagtggacgcagccatctgattttagcagga
gggacggatgccatgagtcatgctcccttattgtttaatcaaaaaatggctgcatggctt
gccaaatggtatgccgctaaaacgtttagacagcgagcaggtttaatcgcagaatttaga
ccttcttatcttgcgcctgttgttgctttattgcgagggttaacagatccgattgttggt
ctaaacatggggcagactgctgaaaaattagcatttaaatttaatattactcgggaacaa
atggatgagtatgcttgtgaaagccatcgtcgattagcagaagcgtttcaggagggacga
atgcaagaagtagttcccatgattgatgcaaaaggaacattgtatcttaaagatgatggt
attcgagaagattcaaccgtagaaaagctggcaaaattaaaaccattttttgacaaaaaa
tatggaatggtaacggcgggaaatagttcacaaattactgatggagcttgtttgttgctt
ttggcaagtgccgaggcagttaaaaaatataagcttcctgttatggggaaaattgttgat
tcccaatgggctgcattagacccggcacagatgggacttgggccagtacatgccgctacc
cccattatggaacgtcagcatttaaaaccgcaggattttgattgctgggaaattaatgaa
gcctttgctgcccaagtgctggcatgccttgctgcctgggatgatgacgaatattgtcgt
actcagttgggattaaagcaggccatgggtgcaccgtctcgtgctgttttaaacaaagat
ggtggtgcaattgctgcggggcatccaattggtgcaagtggtgcacgcattgtattgcat
gtgttgcaggatcttcagcaacgaaatggaacgcgcgggatggccgcaatttgcattggg
ggtggtcagggaggggcgatgtttttggagcgaacgacagaggtaaaaggacatgagtaa

DBGET integrated database retrieval system