KEGG   Legionella oakridgensis: Loa_02759Help
Entry
Loa_02759         CDS       T03928                                 

Definition
(GenBank) putative aminopeptidase
  KO
K05994  bacterial leucyl aminopeptidase [EC:3.4.11.10]
Organism
lok  Legionella oakridgensis
Brite
KEGG Orthology (KO) [BR:lok00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lok01002]
    Loa_02759
Enzymes [BR:lok01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.10  bacterial leucyl aminopeptidase
     Loa_02759
Peptidases and inhibitors [BR:lok01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   Loa_02759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M28 Peptidase_M20 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: AHE68289
UniProt: W0BIR3
Position
complement(2538020..2538676)
Genome map
AA seq 218 aa AA seqDB search
MTSGGRYRQPSLVTVIGKDIQAPAVILGAHMDTLGEHEHERMPGAGDDGSGSATAMEVAR
VLLASDFKLQRPIYIIWYAAEEQGLVGSQQVVRYFLNHAIPVHAAIQFDMTGFRNQPEDK
TIWVFKDYTDKELSAFMTKLIQVYINVPVAYSKCGYGCSDHASWTEAGIPAAFPCETSFE
AHNPYIHTPSDTLDLLNLEHMTNFTRLGLAFAIELAAA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
gtgacaagtggtgggcgttatagacaaccatcgttggttaccgtgattgggaaggatatt
caggcgccggccgtaattcttggtgctcatatggatacacttggcgaacatgagcacgaa
cgaatgcctggtgccggcgatgatggcagtggttccgcaacggcgatggaagtggcgcgt
gttttgttggcttcagactttaaattacagcgtcctatttatattatttggtacgccgct
gaagaacaaggcttggttggctcccaacaggtggtacgctattttctaaatcatgccatt
ccagtgcatgcagccattcaatttgatatgactggttttcgcaatcaacccgaggataag
accatctgggtttttaaggattacactgataaagagttaagtgcttttatgactaagctg
attcaagtatacataaatgttcctgttgcctattccaaatgtggctatggctgcagtgat
catgcatcctggacggaggctggtattccggcggcatttccctgtgaaaccagttttgaa
gcacataacccttacattcatacaccttcggatacgctggatttactcaatcttgagcat
atgaccaattttactcgattgggtcttgcctttgccattgagcttgctgcggcataa

DBGET integrated database retrieval system