KEGG   Lokiarchaeum sp. GC14_75: Lokiarch_11340Help
Entry
Lokiarch_11340    CDS       T04015                                 

Gene name
argF_1
Definition
(GenBank) Ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
loki  Lokiarchaeum sp. GC14_75
Pathway
loki00220  Arginine biosynthesis
loki01100  Metabolic pathways
loki01110  Biosynthesis of secondary metabolites
loki01130  Biosynthesis of antibiotics
loki01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:loki00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Lokiarch_11340 (argF_1)
Enzymes [BR:loki01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     Lokiarch_11340 (argF_1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: KKK45248
UniProt: A0A0F8VLI7
AA seq 310 aa AA seqDB search
MPRHLLKVSDFSKEECEKVINRAIEIKKNSKNYSSALEGETLLMLFEKPSLRTRISFETG
MQQLGGHAIFYSIKDSPLGKKENISDTAKVASRFVNLISARVYKRKDVRDLAKYADVPVI
NMLDDFAHPCQILGDFQTIKEKMGRLDNFKLSYFGDAYNNVTYDLMRMCAIFGLRMDVAC
PKNPEYSPEQIVLDEVSELSKDTGAEVNVVHDALEAAQDSDVLYTDSWMSYGIPESEEKD
RKKAFMPYQVTSSIIGAAKSDAVFMNCLPAMREYEQTAEVIDGSQSIVFDQAENRLHIQK
AIMLFLRDKF
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtcatttattaaaagtttcggacttttcaaaagaagagtgcgagaaggttatt
aatagagctattgagataaagaaaaattctaaaaattatagttctgcattagaaggagaa
acgcttttaatgttatttgaaaaaccatccttacgaactcgtatttcttttgaaacagga
atgcaacaattaggtggacatgcaatattttattcgataaaagactctccccttggtaag
aaggaaaacatcagtgataccgcgaaggttgcatcaagatttgtgaatctaatctcagca
agggtttataaaagaaaagatgttagggatcttgcgaagtatgctgatgttccagtgatt
aacatgcttgatgattttgcgcatccatgtcagatcttgggagactttcaaaccattaag
gaaaaaatgggaaggttagataattttaagttatcctatttcggtgatgcatataataat
gtaacttatgatttaatgagaatgtgtgctatatttggtctgaggatggatgtagcttgc
ccaaaaaaccccgaatattcacctgaacaaatagttttagatgaggtttcagagctctcc
aaagatacgggtgctgaagtaaatgttgttcatgatgctttagaagctgcacaagattca
gatgtgttatataccgatagttggatgtcctatggaattcctgaatctgaagaaaaagat
cggaaaaaagcatttatgccttatcaagttacatcgtcaattatcggagctgcaaaatca
gatgccgtttttatgaattgtttaccagctatgcgtgaatatgaacaaactgctgaagta
attgatggatcccaatcaattgtatttgatcaggcggaaaatcgtttgcacattcagaaa
gcaattatgctttttctacgagataaattctag

DBGET integrated database retrieval system