KEGG   Lokiarchaeum sp. GC14_75: Lokiarch_19470Help
Entry
Lokiarch_19470    CDS       T04015                                 

Definition
(GenBank) Digeranylgeranylglycerophospholipid reductase
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
loki  Lokiarchaeum sp. GC14_75
Pathway
loki00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:loki00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Lokiarch_19470
Enzymes [BR:loki01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     Lokiarch_19470
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     Lokiarch_19470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_3 FAD_oxidored FAD_binding_2 Pyr_redox_3 Pyr_redox_2 Trp_halogenase GIDA Lycopene_cycl HI0933_like Thi4 DAO NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: KKK44271
UniProt: A0A0F8Y7V5
AA seq 368 aa AA seqDB search
MKNFDIVVIGAGPGGSIAAKVAAENGYSTCLIEKEKLNEGGRYKACGGAIAWDLIKDIDY
PEDKISRVIESLELHHLDGKIYSKKGKGAVIWRSTFDNFLTNMASNSGALLKDQESMINI
KKIGDRYQIITEKGKYTTKYVVAADGVTSSVLKLLKWPFFRKEDITLTINQEMKTSRQYI
DKVLGKDSLHLFFGIKTLIPIGYAWLFPKKEMITLGWGSQINLIKNSRKEFKKFITIPFV
KQALKNSKLEIYKPHLIPVGLRPILYSDNVFAIGDAGGFVDPISGKGIPYAMKSGNIAIE
SINTCEKKNTPNRLGNIYEKSLDKRFLKILKLKRVARDKIYKSDETLKKFLSLWEKYRSS
EIVLRKLI
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaagaattttgatattgttgttattggggcaggaccaggaggatcaatagcagctaag
gtagctgctgaaaatggatattcgacctgtttgattgaaaaagaaaaacttaatgaaggg
ggtagatataaagcatgtgggggagcaatagcatgggatttaattaaggatatcgactat
cctgaagacaaaataagccgagttattgagtcattagaattgcatcatcttgatggtaaa
atctattctaaaaaaggaaagggtgctgttatttggcggagtacatttgataattttctg
actaatatggcgtcgaattcaggagcgttactaaaagatcaagaatccatgattaatata
aagaaaataggagataggtatcaaattattactgaaaaagggaaatatactacaaaatat
gtggttgctgctgatggagtaacttcttcggttttaaaattgctaaaatggccctttttc
aggaaagaagatataactctaacaatcaatcaagagatgaagacttcgagacaatatata
gataaagttcttggaaaagactcacttcatctattttttggtattaaaactttaattccc
atcggatatgcatggttattccctaaaaaagaaatgattaccctaggttgggggagtcag
attaatttaataaaaaatagtagaaaggaatttaaaaaattcataacaataccatttgtt
aaacaggcgttaaaaaactcaaaactagaaatttataaaccccacctaattccagtagga
ttaagacctattctttatagtgataatgtttttgcaattggagatgcgggtggatttgta
gatcctataagtggaaaggggataccctatgctatgaagtctgggaatattgcaatagaa
tcaattaacacttgtgaaaagaagaatacacctaataggttaggaaatatctatgaaaaa
tcattagataagagatttttaaaaatattaaaacttaagagagtcgcacgagataaaatt
tataaaagtgacgaaactttgaaaaaatttctatctttgtgggaaaaatatcgcagttca
gaaatagttttgagaaaactaatttag

DBGET integrated database retrieval system