KEGG   Lokiarchaeum sp. GC14_75: Lokiarch_39490
Entry
Lokiarch_39490    CDS       T04015                                 

Gene name
porG
Definition
(GenBank) 2-oxoacid:ferredoxin oxidoreductase, delta subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
loki  Lokiarchaeum sp. GC14_75
Pathway
loki00010  Glycolysis / Gluconeogenesis
loki00020  Citrate cycle (TCA cycle)
loki00620  Pyruvate metabolism
loki00633  Nitrotoluene degradation
loki00640  Propanoate metabolism
loki00650  Butanoate metabolism
loki00680  Methane metabolism
loki00720  Carbon fixation pathways in prokaryotes
loki01100  Metabolic pathways
loki01110  Biosynthesis of secondary metabolites
loki01120  Microbial metabolism in diverse environments
loki01200  Carbon metabolism
Module
loki_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:loki00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lokiarch_39490 (porG)
   00020 Citrate cycle (TCA cycle)
    Lokiarch_39490 (porG)
   00620 Pyruvate metabolism
    Lokiarch_39490 (porG)
   00640 Propanoate metabolism
    Lokiarch_39490 (porG)
   00650 Butanoate metabolism
    Lokiarch_39490 (porG)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Lokiarch_39490 (porG)
   00680 Methane metabolism
    Lokiarch_39490 (porG)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Lokiarch_39490 (porG)
Enzymes [BR:loki01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Lokiarch_39490 (porG)
SSDB
Motif
Pfam: POR Fer4 Fer4_21 Fer4_16 Fer4_7 Fer4_9 Fer4_13 Fer4_10 Fer4_2 Fer4_6 MTHFR_C
Other DBs
NCBI-ProteinID: KKK41847
UniProt: A0A0F8VBV8
AA seq 329 aa
MLTTEQIKEVTKENVINLRFHARAGQGGVTASNLCVETFIGYGVCQPKFGAERMGAPTES
YVRLSLNKDLVRTNEQVYGPHFVAVLDETLLGDIDVTAGMPKGGWLIVNTVMDQISIQDL
VKRKDINVATIDATRIALDILGRNITNTIILGSLIRVSQIFTLDELSDAIMRRFVGAIAG
KNIAAIKQAIEDTCVYDLGLEIDFTLATKVRWQQISLGLPGYQDLDKRGVWYCNEDIIQI
GSDQVNTGSWGEWDILWDKEKCTNCAQCWFICPDFAILREKGEDGLWFMTGIDEFHCKAC
QNCLNICPVDAISKKLKQGPASCAVPEDQ
NT seq 990 nt   +upstreamnt  +downstreamnt
atgctaacaactgaacaaattaaagaagttacaaaagaaaatgttataaatcttcgattt
catgcaagagcgggtcaaggtggtgttactgcttcaaatttatgcgtagagacttttatt
ggatatggtgtttgccaaccaaagtttggagctgaacgaatgggtgctcctacagagagt
tatgttaggttaagcttaaataaagacttggtacgaacaaatgaacaagtttatggccca
cacttcgtagcagtgctagatgaaactctgttaggagacattgatgtgactgctggtatg
cctaaaggtggatggcttatcgtaaatactgtaatggatcaaatatcgattcaagattta
gtaaaaagaaaagatataaatgtcgctacgattgatgctactcgtattgctctagatatt
ttgggaagaaatattactaacacaattattttaggttcattaatacgagtttctcagatt
tttactcttgatgagttatctgatgcaataatgagaagatttgtaggagctattgcagga
aaaaatattgctgcaataaaacaagctatcgaagatacatgtgtatacgatttagggtta
gaaatagacttcacattagcaacaaaagtccgatggcaacaaattagtctaggtttacct
ggttatcaagatcttgacaagcgtggtgtgtggtattgcaatgaggatatcatacaaatt
gggagcgaccaagtgaatacaggatcatggggagaatgggatatcttatgggataaagaa
aaatgtacaaactgcgctcaatgttggtttatttgtcctgatttcgcgatattaagagaa
aaaggagaagatggattatggtttatgactggcatagacgagtttcattgtaaggcttgc
caaaactgtttgaatatttgccctgtagatgctattagcaaaaaattaaaacaaggtcca
gcgtcttgtgctgtgcctgaagatcaatag

DBGET integrated database retrieval system