KEGG   Lokiarchaeum sp. GC14_75: Lokiarch_51490Help
Entry
Lokiarch_51490    CDS       T04015                                 

Gene name
mtrH_3
Definition
(GenBank) Tetrahydromethanopterin S-methyltransferase subunit H
  KO
K00584  tetrahydromethanopterin S-methyltransferase subunit H [EC:2.1.1.86]
Organism
loki  Lokiarchaeum sp. GC14_75
Pathway
loki00680  Methane metabolism
loki01100  Metabolic pathways
loki01120  Microbial metabolism in diverse environments
loki01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:loki00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Lokiarch_51490 (mtrH_3)
Enzymes [BR:loki01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     Lokiarch_51490 (mtrH_3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MtrH
Motif
Other DBs
NCBI-ProteinID: KKK40448
UniProt: A0A0F8V7D6
AA seq 292 aa AA seqDB search
MKEPQYYSYGDIKVGKGNFDLPPVLIGTMFYQNQTLIDRQNPVIFNPEKAKKRISNQIAL
SKKYKIPNLIEISATTPEAMIKYLEFYLDNFEPPFVLGGNFESRNTGIEYLREHGYNPDQ
YIYNTISNLKNKQEVEIIKKYKITSAVVLILGSENMTSTQRFEYITAKNQPGNISILGGL
NNIGVEKIWIDGGVVNLESLAHILETQQLIKTSLQLPVGTAPNLFLFQYSSPKLNIKFHT
RFRRASIMSIASWISNFIFYGAIEDAKESFASTYQSLELKKIVKDRNMKLFY
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagagccacaatactattcctatggggatataaaagtaggtaagggaaattttgat
ttaccacctgttttgattggaacaatgttttatcaaaatcaaactctaatagataggcag
aatcctgtaatctttaatcccgaaaaggctaaaaagcggatttctaaccaaatagcacta
tccaaaaaatataaaataccaaatctaatcgagatttccgcaactacacccgaagctatg
attaaatacctagagttttatttagataattttgaacctccctttgttttaggagggaat
tttgaatcaagaaataccggaattgaatatttacgggaacatgggtacaatccagaccaa
tacatatataacacaatctctaatctcaaaaataaacaagaagtggaaataatcaaaaaa
tataagattacatccgctgtagtgcttatcctcggctcagaaaatatgacttctactcag
agatttgaatatattactgctaaaaatcaacccggcaacattagcatattagggggatta
aataatataggggtagaaaaaatatggattgatgggggtgtagttaatttggaaagctta
gcccatatactggaaactcaacagttgattaaaacttctttacagcttccagttggtaca
gcaccaaacctctttctctttcaatattcttctccaaaacttaacattaagtttcacacc
cggttcaggagagccagtattatgtccatcgcttcatggatttcaaattttattttttat
ggggcaatcgaagatgcaaaggagtcctttgcttctacatatcaatccctagagttaaaa
aaaattgttaaagatcgaaatatgaaactgttttattaa

DBGET integrated database retrieval system