KEGG   Lactobacillus oris: AYI71_06655Help
Entry
AYI71_06655       CDS       T04391                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
lor  Lactobacillus oris
Pathway
lor00471  D-Glutamine and D-glutamate metabolism
lor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lor00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AYI71_06655
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lor01011]
    AYI71_06655
Enzymes [BR:lor01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     AYI71_06655
Peptidoglycan biosynthesis and degradation proteins [BR:lor01011]
 Precursor biosynthesis
  Racemase
   AYI71_06655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race Glycos_transf_1
Motif
Other DBs
NCBI-ProteinID: AMS08485
Position
complement(1320786..1321592)
Genome map
AA seq 268 aa AA seqDB search
MDNRPIGVMDSGLGGLSVVRVIQQKLPNEEVIFVGDQGHFPYGTKDQAEVRQLALSIGSF
LLKHDVKMMVVACNTATAAALPALQAALPIPVIGVIEPGARAALAQDKKGPIGVIATTAT
TTAGAYPATIERLAPGTPVIAKATQPMVEIVERGQTGTAKAQEVVSEQLMTFKEHPVKTL
IMGCTHFPFLAPEISKAVGPTVALVDPAKETVATAKSWLEQHQAMGNHAHPNYHLYSTGN
LPDLRAGVNKWLLSGHFDLGTAQIEEGD
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggacaatcgcccaattggagtgatggattctggcttggggggcctttcagtcgtccgg
gttatccaacaaaaactacccaacgaagaggtcatcttcgtgggcgaccaaggtcacttc
ccgtacggaaccaaggatcaagcggaggtccgtcaactggcgctctcgattggttccttt
ttactcaagcatgacgtaaagatgatggtcgtggcctgcaatacggcgacggcggccgca
ctgccggccctgcaagcggcgctcccaattcccgtaattggggtcattgagcccggcgcc
cgggcggccctggcccaggataaaaagggaccgattggggtgatcgccaccacagcaacc
accacggccggcgcctacccagctacgatcgaacggctagcgccgggtaccccggtcatt
gcaaaggccacccagccaatggtcgaaatcgttgagcgcggccagaccgggacggcgaag
gcccaagaagtggttagtgaacagctaatgacctttaaagagcacccggtaaaaaccctg
attatgggctgcacccacttcccgtttttggccccggaaataagtaaggcggtcggacca
acggtggccttagtcgacccggctaaggaaacggtggccacggccaagtcctggctggaa
cagcaccaagcaatgggtaaccacgcccaccccaactaccacctatattcaacgggcaac
ctccctgacttaagggccggggtgaataagtggttgttgtcggggcactttgacttagga
accgcccaaattgaagagggggattaa

DBGET integrated database retrieval system