KEGG   Lactobacillus oris: AYI71_11420Help
Entry
AYI71_11420       CDS       T04391                                 

Definition
(GenBank) asparaginyl/glutamyl-tRNA amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
lor  Lactobacillus oris
Pathway
lor00970  Aminoacyl-tRNA biosynthesis
lor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lor00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AYI71_11420
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lor03029]
    AYI71_11420
Enzymes [BR:lor01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AYI71_11420
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AYI71_11420
Mitochondrial biogenesis [BR:lor03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AYI71_11420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: AMS09310
UniProt: A0A142KT72
Position
2306440..2306760
Genome map
AA seq 106 aa AA seqDB search
MAEQLDRQQVEHVADLAKLAFTDAELDKFTPQLEEIIDLFKELEEVDTTGVEPMSTPTTE
VNVMREDVAVKSSDQERQALLDNAPETANGLIKVPAIIDESEDGEE
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcaattagaccggcaacaggtcgaacacgttgcggacctggccaagctggcg
tttaccgatgcggagttggacaagttcaccccccaactcgaagaaatcattgacctgttc
aaggaactggaagaggtcgatacgaccggcgtggaaccaatgagtacgccaacgacggaa
gtcaacgtgatgcgagaagacgtggcggttaagagcagcgaccaagaacgccaagccctg
ttggataacgctccggaaacggctaacggcttaatcaaggtgccagcgatcatcgacgaa
agcgaggacggagaagagtaa

DBGET integrated database retrieval system