KEGG   Lactobacillus oris: AYI71_14010Help
Entry
AYI71_14010       CDS       T04391                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lor  Lactobacillus oris
Pathway
lor00071  Fatty acid degradation
lor00072  Synthesis and degradation of ketone bodies
lor00280  Valine, leucine and isoleucine degradation
lor00310  Lysine degradation
lor00362  Benzoate degradation
lor00380  Tryptophan metabolism
lor00620  Pyruvate metabolism
lor00630  Glyoxylate and dicarboxylate metabolism
lor00640  Propanoate metabolism
lor00650  Butanoate metabolism
lor00900  Terpenoid backbone biosynthesis
lor01100  Metabolic pathways
lor01110  Biosynthesis of secondary metabolites
lor01120  Microbial metabolism in diverse environments
lor01130  Biosynthesis of antibiotics
lor01200  Carbon metabolism
lor01212  Fatty acid metabolism
lor02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AYI71_14010
   00630 Glyoxylate and dicarboxylate metabolism
    AYI71_14010
   00640 Propanoate metabolism
    AYI71_14010
   00650 Butanoate metabolism
    AYI71_14010
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AYI71_14010
   00072 Synthesis and degradation of ketone bodies
    AYI71_14010
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AYI71_14010
   00310 Lysine degradation
    AYI71_14010
   00380 Tryptophan metabolism
    AYI71_14010
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AYI71_14010
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AYI71_14010
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AYI71_14010
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lor04147]
    AYI71_14010
Enzymes [BR:lor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AYI71_14010
Exosome [BR:lor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AYI71_14010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III MelC1
Motif
Other DBs
NCBI-ProteinID: AMS09749
UniProt: A0A142KUG1
Position
complement(2823052..2824224)
Genome map
AA seq 390 aa AA seqDB search
MEKVVFVGAARTPIGKLGGALATLTAAQLGTIAIQAALERAAVAPEEVNEVYLGCAIQAG
QGQNVARQASIAAGLPVTVPATTVNVMCGSGMHAVNLAAKLIAMGDAEVMVAGGTESMST
APYLVPKGRFGYKYGNAELVDALYKDGLEDAFFHYPMGCTAENLVEKYQVTREDLDHFAL
QSQVRARAAQDTGRFKDEIVPVTVKGKRHQLEVTEDEAIRDTTMEKLAALKPVFKEGGDV
TAGNSSGLNDGAAALILMSERRALAEGKEILGYWQAGTLAGVKPELMGIGPLVATKKLLA
QVNMTPDQLDLIEINEAFAAQAIVCQRELGFEESKVNVNGGAIALGHPLGDSGARILVTL
LYQMKRQNAKRGLGTLCIGGGMGAATLVYR
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagttgttttcgttggagctgcacggacgccgattggaaagctcggtggcgcc
ctggccacactgaccgctgcccagttgggaacaattgccatccaggccgccttagagcgg
gccgcggttgcccccgaagaagtgaatgaggtctacctgggctgcgccatccaggccggc
caggggcaaaacgtcgcccgccaggccagcattgccgccgggttgccggttaccgttccg
gccaccaccgttaacgtgatgtgtggttccggaatgcacgccgttaacctagcggcgaag
ctgattgccatgggggacgccgaagtgatggtggcggggggcaccgaaagcatgtcaacg
gctccctacttagtaccaaaggggcgctttggttacaagtacggtaacgccgaactggtc
gacgccctgtataaggacgggttggaagacgccttcttccactacccaatgggctgcacc
gccgaaaacctggtcgaaaagtaccaggtgaccagagaagacctcgaccacttcgccctg
caaagccaagtgcgggcacgggcggcgcaagacacggggcgttttaaagacgaaatcgtg
ccggtgaccgtcaagggcaagcgccaccaacttgaagttacagaagacgaggcgattcgc
gacacgacgatggaaaaattagcggccttaaagccggtctttaaagaaggtggcgacgtg
acggccggcaattcttccggattaaatgacggcgccgctgctttaatcctaatgagcgaa
cgccgggctctggcggaaggcaaggaaatcctcggctactggcaggccggcaccttggcc
ggggtcaagccggaactgatggggatcggccccttggtggccaccaagaagctgctcgcc
caggttaacatgacgcccgaccagcttgacctgatcgaaattaacgaagcctttgccgcc
caagcgatcgtttgccagcgcgaattgggcttcgaggagagcaaggtgaacgtcaacggt
ggggcaattgcccttggtcatcccctgggcgactccggggcccgcattttggtgacccta
ctctaccaaatgaagcgccaaaacgccaagcgggggctggggaccctgtgcattggcggc
ggaatgggcgctgccaccctcgtctaccgttag

DBGET integrated database retrieval system