KEGG   Lactobacillus oris: AYI71_14235Help
Entry
AYI71_14235       CDS       T04391                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lor  Lactobacillus oris
Pathway
lor00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AYI71_14235
Enzymes [BR:lor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AYI71_14235
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AYI71_14235
    1.1.1.-  
     AYI71_14235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C ADH_N_assoc Pyr_redox_2 F420_oxidored Pyr_redox 2-Hacid_dh_C 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AMS09785
UniProt: A0A142KUJ7
Position
complement(2867703..2868755)
Genome map
AA seq 350 aa AA seqDB search
MKAAVWHGAKDIRVEDVDLKPTKDNEVVVKVAWTGICGSDLHEYQEGPIFIPVGHKDELT
GGEAPVTLGHEFCGVIEKVGKDVTKFKVGDHVSVNPTVTHGKVPDNVDVYDGYSFIGLAC
DGGLAPLVNISEENLYLLPKDFPLRIAATIEPTAVAVQAIKEGGLKFGENVAIFGAGPIG
VLVAAAAKAAGASKIIVSDLSEVRLKKALEMGATDVIKSDQEDAVKKIKELVPGGVDVSF
EVAGVKPTFDQAIEATKARGTMVIVAIYGHPIEFNPMQLTNTGVKITSTIAYSRETFQQT
VDLVTKGSLVVEPVITKEITIDQVVSDGFETLTNDKAQAKILINVDGEDD
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcagtttggcatggtgcaaaagacattcgggttgaagatgttgatctgaaa
ccaactaaggataacgaagtggtggttaaggttgcctggactggaatttgtgggagtgat
ctccacgaataccaagagggaccaatcttcatcccggtcggccacaaggatgaattaacc
ggtggtgaagctccggtgaccttgggccacgaattttgcggggtaattgagaaggttggt
aaagacgttaccaagtttaaggttggcgaccacgttagcgttaacccgactgtcacccac
ggcaaggttcccgacaacgttgacgtatacgacggctactccttcatcggacttgcttgc
gatggtggtttagcgccgttagttaacatctcggaagaaaacctctacctacttccaaag
gacttcccgttgcggattgcagccaccattgaaccaacggcggtggccgttcaagccatc
aaggaaggtggcctcaagtttggtgaaaacgtggccatcttcggggcaggtccaattggg
gtcttggtagcggcggcggccaaggcggccggggcctccaagatcattgtttccgacctg
tcagaggttcgtttgaagaaggcccttgaaatgggggcgaccgacgtcatcaagtccgac
caagaagacgccgtgaagaagattaaagagctcgttccgggcggggtcgatgtctccttt
gaagtggctggggtaaagccaacctttgaccaagccatcgaagccactaaggcacggggg
acgatggtaattgtggccatttacggccacccaatcgaatttaacccaatgcagctgacc
aataccggggttaagatcaccagcacaatcgcttactcccgggaaaccttccaacaaacg
gtcgacctggttaccaagggctcgttggttgtggaaccggtcatcaccaaggaaatcacg
atcgatcaagtggtatccgatgggtttgaaaccctcaccaatgataaggcccaagcaaag
attttgatcaacgtcgatggcgaagacgactag

DBGET integrated database retrieval system